Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha/beta R2, Mouse (HEK293, His)

IFN-α/β R2 protein and IFNAR1 together constitute the heterodimeric receptor of type I interferon and initiate the JAK-STAT signaling cascade. Upon binding of type I interferons, IFNAR1 and IFNAR2 activate related Janus kinases (TYK2 and JAK1) in proximity, resulting in cross-phosphorylation. IFN-alpha/beta R2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-alpha/beta R2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IFN-alpha/beta R2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-beta-r2-protein-mouse-hek293-his.html

Purity

98.0

Smiles

SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA

Molecular Formula

15976 (Gene_ID) O35664-1 (S22-A242) (Accession)

Molecular Weight

Approximately 37-57 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chlorobenzo[c][1,2,5]thiadiazole
JH918835 1 Each

4-Chlorobenzo[c][1,2,5]thiadiazole

Sign In for Pricing
View Details
C20orf30 Antibody - C-terminal region : HRP (ARP44585_P050-HRP)
ARP44585_P050-HRP 100 µL

C20orf30 Antibody - C-terminal region : HRP (ARP44585_P050-HRP)

Sign In for Pricing
View Details
CADM3 Polyclonal Antibody, Cy5.5 Conjugated
bs-6027R-Cy5.5 100 µL

CADM3 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-OCT-2 (POU2F2) (B-Cell Marker) Monoclonal Antibody (Clone: 86474)
36-2975-100 100 µg

Anti-OCT-2 (POU2F2) (B-Cell Marker) Monoclonal Antibody (Clone: 86474)

Sign In for Pricing
View Details
Rabbit Endoplasmic Reticulum Aminopeptidase 1 (ERAP1) ELISA Kit
MBS9388854 Inquire

Rabbit Endoplasmic Reticulum Aminopeptidase 1 (ERAP1) ELISA Kit

Sign In for Pricing
View Details
VPS54 antibody
70R-3690 100 µL

VPS54 antibody

Sign In for Pricing
View Details