Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tceb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7098905 3x 1.0 µg

Tceb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
HSF1 (Phospho Ser320) (13P5) Rabbit Monoclonal Antibody
E28G2420 100 µL

HSF1 (Phospho Ser320) (13P5) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Rbp7 shRNA (UAS) - Lentiviral mouse Rbp7 shRNA (UAS, RFP) plasmid
GTR15215305 1 Vial

Lentiviral mouse Rbp7 shRNA (UAS) - Lentiviral mouse Rbp7 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
IRGM Polyclonal Antibody
BT-AP10497-01 20 µL

IRGM Polyclonal Antibody

Sign In for Pricing
View Details
IRGM Polyclonal Antibody
BT-AP10497-02 50 µL

IRGM Polyclonal Antibody

Sign In for Pricing
View Details
IRGM Polyclonal Antibody
BT-AP10497-03 100 µL

IRGM Polyclonal Antibody

Sign In for Pricing
View Details