Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TIMM8A Antibody [Alexa Fluor 350]
NBP2-98033AF350 0.1 mL

Rabbit Polyclonal TIMM8A Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Nurr1 (m2) -PR
sc-270257-PR 10 µM - 20 µL

Nurr1 (m2) -PR

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein tam12 (tam12)
MBS1137135-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein tam12 (tam12)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein tam12 (tam12)
MBS1137135-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein tam12 (tam12)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein tam12 (tam12)
MBS1137135-03 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein tam12 (tam12)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein tam12 (tam12)
MBS1137135-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein tam12 (tam12)

Sign In for Pricing
View Details