Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xanthurenic acid
MBS3847078-01 100 mg

Xanthurenic acid

Sign In for Pricing
View Details
Xanthurenic acid
MBS3847078-02 500 mg

Xanthurenic acid

Sign In for Pricing
View Details
Xanthurenic acid
MBS3847078-03 5x 500 mg

Xanthurenic acid

Sign In for Pricing
View Details
SLC25A38 (NM_017875) Human Tagged ORF Clone Lentiviral Particle
RC201905L3V 200 µL

SLC25A38 (NM_017875) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Gm14458 ORF Vector (Mouse) (pORF)
ORF045812 1.0 µg DNA

Gm14458 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human Desmocollin-3 ELISA Kit (Colorimetric)
NBP3-31386 1 Kit

Human Desmocollin-3 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details