Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS4 (NM_002495) Human Recombinant Protein
TP302713L 1 mg

NDUFS4 (NM_002495) Human Recombinant Protein

Sign In for Pricing
View Details
DDX18P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV759869 1.0 µg DNA

DDX18P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RPL24 Antibody
A33652-100UL 100 µL

RPL24 Antibody

Sign In for Pricing
View Details
RING1 (Ring Finger Protein 1, Ring1A, RNF1) (HRP)
251129-HRP 100 µL

RING1 (Ring Finger Protein 1, Ring1A, RNF1) (HRP)

Sign In for Pricing
View Details
Mrps17 (NM_025450) Mouse Recombinant Protein
PM48993M5 20 µg

Mrps17 (NM_025450) Mouse Recombinant Protein

Sign In for Pricing
View Details
Galnt10 (BC016585) Mouse Tagged ORF Clone Lentiviral Particle
MR205063L3V 200 µL

Galnt10 (BC016585) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details