CG alpha, Human (HEK293, His)
The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CG alpha Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html
Purity
95.0
Smiles
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular Formula
1081 (Gene_ID) P01215 (A25-S116) (Accession)
Molecular Weight
20-28 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Rdh14 sgRNA CRISPR Lentivector (Rat) (Target 3)
Canine Ion Channel Sperm Associated Protein 4 (SPER4) ELISA Kit
Canine Ion Channel Sperm Associated Protein 4 (SPER4) ELISA Kit
Canine Ion Channel Sperm Associated Protein 4 (SPER4) ELISA Kit
Canine Ion Channel Sperm Associated Protein 4 (SPER4) ELISA Kit
