Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human VEGFA Protein, None-tagged, Alexa Fluor 488 conjugated
VEGFA-7310HAF488 20 μg- 50 μg- 100 μg

Recombinant Human VEGFA Protein, None-tagged, Alexa Fluor 488 conjugated

Sign In for Pricing
View Details
EHF Protein Vector (Mouse) (pPM-C-His)
PV174857 500 ng

EHF Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Anti-GST Antibody
An-388C 25 mL

Anti-GST Antibody

Sign In for Pricing
View Details
Doublecortin discontinued
343007-01 100 µL

Doublecortin discontinued

Sign In for Pricing
View Details
Doublecortin discontinued
343007-02 200 µL

Doublecortin discontinued

Sign In for Pricing
View Details
RWDD1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV785471 1.0 µg DNA

RWDD1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details