Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pomp Mouse qPCR Primer Pair (NM_025624)
MP211900 200 Reactions

Pomp Mouse qPCR Primer Pair (NM_025624)

Sign In for Pricing
View Details
TAK1 Antibody
MBS8000679-01 0.1 mg

TAK1 Antibody

Sign In for Pricing
View Details
TAK1 Antibody
MBS8000679-02 5x 0.1 mg

TAK1 Antibody

Sign In for Pricing
View Details
BIOARRAYTM Eukaryotic hybridization controls
ENZ-42661-150 150 Reactions

BIOARRAYTM Eukaryotic hybridization controls

Sign In for Pricing
View Details
RPS15 Recombinant Protein (Human)
RP043006 100 µg

RPS15 Recombinant Protein (Human)

Sign In for Pricing
View Details
Sheep Tox IgG antibody (Tox IgG Ab) ELISA Kit
YP-W79260-01 48 Tests

Sheep Tox IgG antibody (Tox IgG Ab) ELISA Kit

Sign In for Pricing
View Details