Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB8 Recombinant Protein (Rat)
RP222629 100 µg

PSMB8 Recombinant Protein (Rat)

Sign In for Pricing
View Details
SNX3 (NM_001300929) Human Tagged ORF Clone
RC235976 10 µg

SNX3 (NM_001300929) Human Tagged ORF Clone

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to GRB2 Associated Binding Protein 3 (GAB3)
MBS2084249-01 0.1 mL

HRP-Linked Polyclonal Antibody to GRB2 Associated Binding Protein 3 (GAB3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to GRB2 Associated Binding Protein 3 (GAB3)
MBS2084249-02 0.2 mL

HRP-Linked Polyclonal Antibody to GRB2 Associated Binding Protein 3 (GAB3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to GRB2 Associated Binding Protein 3 (GAB3)
MBS2084249-03 0.5 mL

HRP-Linked Polyclonal Antibody to GRB2 Associated Binding Protein 3 (GAB3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to GRB2 Associated Binding Protein 3 (GAB3)
MBS2084249-04 1 mL

HRP-Linked Polyclonal Antibody to GRB2 Associated Binding Protein 3 (GAB3)

Sign In for Pricing
View Details