Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CXADR Antibody (068) [Alexa Fluor 647]
NBP2-89644AF647 0.1 mL

Rabbit Monoclonal CXADR Antibody (068) [Alexa Fluor 647]

Sign In for Pricing
View Details
RBP5 (HRP)
574459-01 50 µg

RBP5 (HRP)

Sign In for Pricing
View Details
RBP5 (HRP)
574459-02 100 µg

RBP5 (HRP)

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila gpsA Protein (aa 1-329)
VAng-Lsx3913-50gEcoli 50 µg (E. coli)

Recombinant Legionella Pneumophila gpsA Protein (aa 1-329)

Sign In for Pricing
View Details
MMP11 (Stromelysin-3, Matrix Metallopeptidase 11)
485931 100 µL

MMP11 (Stromelysin-3, Matrix Metallopeptidase 11)

Sign In for Pricing
View Details
Il20 3'UTR Luciferase Stable Cell Line
TU206231 1.0 mL

Il20 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details