Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3FA (HIST1H3A) Rabbit Polyclonal Antibody
TA377070 100 µL

H3FA (HIST1H3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Monoclonal Ly-6E Antibody (RG7841) [Janelia Fluor 635]
NBP3-28064JF635 0.1 mL

Human Monoclonal Ly-6E Antibody (RG7841) [Janelia Fluor 635]

Sign In for Pricing
View Details
GNB1 Rabbit Polyclonal Antibody
E53P06869 100 µL

GNB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olfr1209 (NM_146461) Mouse Tagged Lenti ORF Clone
MR215083L4 10 µg

Olfr1209 (NM_146461) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DRAM2 siRNA (Mouse)
MBS8205096-01 15 nmol

DRAM2 siRNA (Mouse)

Sign In for Pricing
View Details
DRAM2 siRNA (Mouse)
MBS8205096-02 30 nmol

DRAM2 siRNA (Mouse)

Sign In for Pricing
View Details