Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin L (APC)
C2097-70-APC 100 µL

Cathepsin L (APC)

Sign In for Pricing
View Details
Rat St8sia5 Pre-designed siRNA Set B
SI213844B 1 Each

Rat St8sia5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human GSTM2 AssayLite™ Antibody (FITC Conjugate)
33169-05141 2x 75 µg

Human GSTM2 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Sertraline Carbamoyl Glucuronide Methyl Ester
020923 2.5 mg

Sertraline Carbamoyl Glucuronide Methyl Ester

Sign In for Pricing
View Details
Procalcitonin Porcine
32-6626-10 10 µg

Procalcitonin Porcine

Sign In for Pricing
View Details
AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (FITC)
123087-FITC 100 µL

AHNAK (Neuroblast Differentiation-associated Protein AHNAK, Desmoyokin, PM227, MGC5395) (FITC)

Sign In for Pricing
View Details