Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) FMP52 Polyclonal Antibody
MBS7197751 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) FMP52 Polyclonal Antibody

Sign In for Pricing
View Details
RPL21P101 sgRNA CRISPR Lentivector (Human) (Target 1)
K1932602 1.0 µg DNA

RPL21P101 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GPX7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0902906 1.0 µg DNA

GPX7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human FAM3B (Family With Sequence Similarity 3, Member B) ELISA Kit
EK245719 96 Well

Human FAM3B (Family With Sequence Similarity 3, Member B) ELISA Kit

Sign In for Pricing
View Details
iGFBP Strip
INV-151 3.0 mm (single pouch) 100pouches/box

iGFBP Strip

Sign In for Pricing
View Details
Gm6115 3'UTR Luciferase Stable Cell Line
TU108356 1.0 mL

Gm6115 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details