Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabenosyn 5 (RBSN) (NM_001302378) Human Untagged Clone
SC337449 10 µg

Rabenosyn 5 (RBSN) (NM_001302378) Human Untagged Clone

Sign In for Pricing
View Details
ELISA kit for Human CD97 (Cluster of Differentiation 97)
E-EL-H0750 96 Tests

ELISA kit for Human CD97 (Cluster of Differentiation 97)

Sign In for Pricing
View Details
B7H4 (VTCN1) (NM_024626) Human Over-expression Lysate
LC403017 20 µg

B7H4 (VTCN1) (NM_024626) Human Over-expression Lysate

Sign In for Pricing
View Details
CYP11B2, ID (CYP11B2, Cytochrome P450 11B2, mitochondrial, Aldosterone synthase, Aldosterone-synthesizing enzyme, CYPXIB2, Cytochrome P-450Aldo, Cytochrome P-450C18, Steroid 18-hydroxylase) (MaxLight 650) discontinued
034422-ML650 100 µL

CYP11B2, ID (CYP11B2, Cytochrome P450 11B2, mitochondrial, Aldosterone synthase, Aldosterone-synthesizing enzyme, CYPXIB2, Cytochrome P-450Aldo, Cytochrome P-450C18, Steroid 18-hydroxylase) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Pyrophosphatase, Inorganic GMP-grade (1 U/μL)
10620ES10 10 U

Pyrophosphatase, Inorganic GMP-grade (1 U/μL)

Sign In for Pricing
View Details
C1orf53 (NM_001024594) Human Recombinant Protein
TP324510M 100 µg

C1orf53 (NM_001024594) Human Recombinant Protein

Sign In for Pricing
View Details