Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 Kip1 (1A7) Mouse Monoclonal Antibody
E28PM33075 100 µL

P27 Kip1 (1A7) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Human CHKB (Choline/ethanolamine kinase) ELISA Kit
EH14191 96 Tests

Human CHKB (Choline/ethanolamine kinase) ELISA Kit

Sign In for Pricing
View Details
TMEM140 ORF Vector (Human) (pORF)
ORF010641 1.0 µg DNA

TMEM140 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CD45RC (Leukocyte Common Antigen HMW, LCA, Ly-5 T200) (MaxLight 550) discontinued
C2400-59A-ML550 100 µL

CD45RC (Leukocyte Common Antigen HMW, LCA, Ly-5 T200) (MaxLight 550) discontinued

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
MBS2150721-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)
MBS2150721-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Gamma (CD3g)

Sign In for Pricing
View Details