Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SB-743921
E4595-25mg 25 mg

SB-743921

Sign In for Pricing
View Details
DPYS Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV664025 1.0 µg DNA

DPYS Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
VPS54 Rabbit Polyclonal Antibody
E28PT4890 100 µL

VPS54 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRIM25 CRISPR All-in-one AAV vector set (with saCas9)(Human)
47758151 3x 1.0 µg DNA

TRIM25 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Lentiviral mouse Doxl2 shRNA (UAS) - Lentiviral mouse Doxl2 shRNA (UAS, iRFP) plasmid
GTR15274048 1 Vial

Lentiviral mouse Doxl2 shRNA (UAS) - Lentiviral mouse Doxl2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) IPMS1 Polyclonal Antibody
MBS9009334 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) IPMS1 Polyclonal Antibody

Sign In for Pricing
View Details