Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gsh1 (GSX1) (NM_145657) Human Over-expression Lysate
LC407912 20 µg

Gsh1 (GSX1) (NM_145657) Human Over-expression Lysate

Sign In for Pricing
View Details
Cryaa (NM_012534) Rat Tagged Lenti ORF Clone
RR201509L3 10 µg

Cryaa (NM_012534) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lin28B Rabbit Monoclonal Antibody
E56G5094 100 µL

Lin28B Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ACOX2 3'UTR GFP Stable Cell Line
TU050181 1.0 mL

ACOX2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Alpha-2-Heremans Schmid Glycoprotein (AHSG) Antibody Pair
abx370353-01 5x 96 Tests

Alpha-2-Heremans Schmid Glycoprotein (AHSG) Antibody Pair

Sign In for Pricing
View Details
Alpha-2-Heremans Schmid Glycoprotein (AHSG) Antibody Pair
abx370353-02 10x 96 Tests

Alpha-2-Heremans Schmid Glycoprotein (AHSG) Antibody Pair

Sign In for Pricing
View Details