CG alpha, Human (HEK293, His)
The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CG alpha Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html
Purity
95.0
Smiles
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular Formula
1081 (Gene_ID) P01215 (A25-S116) (Accession)
Molecular Weight
20-28 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Lentiviral human USP46 shRNA (UAS) - Lentiviral human USP46 shRNA (UAS, GFP) plasmid
CD300LB, NT (CD300LB, CD300B, CLM7, CMRF35A2, IREM3, LMIR5, TREM5, CMRF35-like molecule 7, CD300 antigen-like family member B, CMRF35-A2, Immune receptor expressed on myeloid cells 3, Leukocyte mono-Ig-like receptor 5, Triggering receptor expressed on myeloid cells 5, CD300b) (MaxLight 750) discontinued