Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP104 Knockout NCI-H1975 Polyclonal Cells
ARG17029 1 Million

CEP104 Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
OS9 (NM_006812) Human Recombinant Protein
TP318206 20 µg

OS9 (NM_006812) Human Recombinant Protein

Sign In for Pricing
View Details
THY1 protein, Human, Recombinant (His)
E51P90165 20 µg

THY1 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
BCAN ORF Vector (Human) (pORF)
ORF000960 1.0 µg DNA

BCAN ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Semaphorin 5A (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (MaxLight 405)
MBS6498730-01 0.1 mL

Semaphorin 5A (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (MaxLight 405)

Sign In for Pricing
View Details
Semaphorin 5A (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (MaxLight 405)
MBS6498730-02 5x 0.1 mL

Semaphorin 5A (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (MaxLight 405)

Sign In for Pricing
View Details