Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mpp7 3'UTR Luciferase Stable Cell Line
TU213346 1.0 mL

Mpp7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lonp2 Rat shRNA Plasmid (Locus ID 291922)
TL703204 1 Kit

Lonp2 Rat shRNA Plasmid (Locus ID 291922)

Sign In for Pricing
View Details
SOX21 (Transcription Factor SOX-21, SOX-A, SOX25, SOXA) (MaxLight 650)
133720-ML650 100 µL

SOX21 (Transcription Factor SOX-21, SOX-A, SOX25, SOXA) (MaxLight 650)

Sign In for Pricing
View Details
INTS3 (NM_023015) Human Untagged Clone
SC318460 10 µg

INTS3 (NM_023015) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Bace1 ELISA Kit
EF013095 96 Tests

Mouse Bace1 ELISA Kit

Sign In for Pricing
View Details
ABCG2 siRNA (Human)
CRH6254-01 15 nmol

ABCG2 siRNA (Human)

Sign In for Pricing
View Details