Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1042 Mouse shRNA Plasmid (Locus ID 257941)
TL507571 1 Kit

Olfr1042 Mouse shRNA Plasmid (Locus ID 257941)

Sign In for Pricing
View Details
ZCCHC16 Lentiviral Activation Particles (h)
sc-415549-LAC 200 µL

ZCCHC16 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Human Myocardin (MYOCD) ELISA Kit
MBS9715073-01 48 Tests

Human Myocardin (MYOCD) ELISA Kit

Sign In for Pricing
View Details
Human Myocardin (MYOCD) ELISA Kit
MBS9715073-02 96 Tests

Human Myocardin (MYOCD) ELISA Kit

Sign In for Pricing
View Details
Human Myocardin (MYOCD) ELISA Kit
MBS9715073-03 5x 96 Tests

Human Myocardin (MYOCD) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 35, IL-35 GENLISA ELISA
KLR2118 96 Well

Rat Interleukin 35, IL-35 GENLISA ELISA

Sign In for Pricing
View Details