Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CG alpha, Human (HEK293, His)

The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CG alpha Protein, Human (HEK293, His) is the recombinant human-derived CG alpha protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CG alpha Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cg-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Molecular Formula

1081 (Gene_ID) P01215 (A25-S116) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM39 Over-expression Lysate Product
GWB-928831 0.1 mg

RBM39 Over-expression Lysate Product

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM6/CD66c Antibody (439424) [PE/Atto594]
FAB3934PEATT594 0.1 mL

Mouse Monoclonal CEACAM6/CD66c Antibody (439424) [PE/Atto594]

Sign In for Pricing
View Details
Mouse mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit
EIA07756m 1 Kit

Mouse mitochondrial tumor suppressor 1 (MTUS1) ELISA Kit

Sign In for Pricing
View Details
HIST1H4D 3'UTR Luciferase Stable Cell Line
TU009854 1.0 mL

HIST1H4D 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monkey Mixed lineage kinase domain like pseudokinase ELISA Kit
MBS7274928-01 48 Well

Monkey Mixed lineage kinase domain like pseudokinase ELISA Kit

Sign In for Pricing
View Details
Monkey Mixed lineage kinase domain like pseudokinase ELISA Kit
MBS7274928-02 96 Well

Monkey Mixed lineage kinase domain like pseudokinase ELISA Kit

Sign In for Pricing
View Details