Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) (Active)

Product Specifications

Product Name Alternative

Granulocyte-macrophage colony-stimulating factor; Csf2; GM-CSF; Colony-stimulating factor; Csfgm

Abbreviation

Recombinant Mouse Csf2 protein (Active)

Gene Name

Csf2

UniProt

P01587

Expression Region

18-141aa

Organism

Mus musculus (Mouse)

Target Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Granulocyte-Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factorthat can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by anumber of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cellsand fibroblasts) in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophageprogenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. Onmature hematopoietic, monocytes/ macrophages and eosinophils. GM-CSF has a functional role on nonhematopoitic cells. It can induce human endothelial cells to migrate and proliferate. Additionally, GM-CSF canalso stimulate the proliferation of a number of tumor cell lines, including osteogenic sarcoma, carcinoma andadenocarcinoma cell lines.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 15-50 pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HMG2L1 Polyclonal Antibody
bs-51079R 100 µL

HMG2L1 Polyclonal Antibody

Ask
View Details
HLA-DQB2 (HLA Class II Histocompatibility Antigen, DQ beta 2 Chain, HLA Class II Histocompatibility Antigen, DX beta Chain, MHC Class II Antigen DQB2, HLA-DXB) (PE)
127924-PE 100 µL

HLA-DQB2 (HLA Class II Histocompatibility Antigen, DQ beta 2 Chain, HLA Class II Histocompatibility Antigen, DX beta Chain, MHC Class II Antigen DQB2, HLA-DXB) (PE)

Ask
View Details
TRADD (Tumor Necrosis Factor Receptor Type 1-associated DEATH Domain Protein, TNFR1-associated DEATH Domain Protein, TNFRSF1A-associated Via Death Domain) (AP)
MBS6134290-01 0.1 mL

TRADD (Tumor Necrosis Factor Receptor Type 1-associated DEATH Domain Protein, TNFR1-associated DEATH Domain Protein, TNFRSF1A-associated Via Death Domain) (AP)

Ask
View Details
TRADD (Tumor Necrosis Factor Receptor Type 1-associated DEATH Domain Protein, TNFR1-associated DEATH Domain Protein, TNFRSF1A-associated Via Death Domain) (AP)
MBS6134290-02 5x 0.1 mL

TRADD (Tumor Necrosis Factor Receptor Type 1-associated DEATH Domain Protein, TNFR1-associated DEATH Domain Protein, TNFRSF1A-associated Via Death Domain) (AP)

Ask
View Details
Human TL1A Antibody (Biotin Conjugate)
32653-05121 150 µg

Human TL1A Antibody (Biotin Conjugate)

Ask
View Details
Lentiviral human TMEM187 sgRNA gene knockout kit - Lentiviral human TMEM187 sgRNA gene knockout kit (plasmid)
GTR15357425 1 Vial

Lentiviral human TMEM187 sgRNA gene knockout kit - Lentiviral human TMEM187 sgRNA gene knockout kit (plasmid)

Ask
View Details