GRO-alpha/CXCL1, Mouse

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Mouse is produced in E. coli, and consists of 72 amino acids (A25-N96) .

Product Specifications

Product Name Alternative

GRO-alpha/CXCL1 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-alpha-cxcl1-protein-mouse.html

Purity

98.0

Smiles

APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Molecular Formula

14825 (Gene_ID) P12850 (A25-K96) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Dhawan P, et al. Role of CXCL1 in tumorigenesis of melanoma. J Leukoc Biol. 2002 Jul;72 (1) :9-18.|[2]Jan Korbecki, et al. CXCL1: Gene, Promoter, Regulation of Expression, mRNA Stability, Regulation of Activity in the Intercellular Space. Int J Mol Sci. 2022 Jan 12;23 (2) :792.|[3]Sheng-Mou Hou, et al. CXCL1 contributes to IL-6 expression in osteoarthritis and rheumatoid arthritis synovial fibroblasts by CXCR2, c-Raf, MAPK, and AP-1 pathway. Arthritis Res Ther. 2020 Oct 21;22 (1) :251.|[4]Huey-ming Lo, et al. TNF-α induces CXCL1 chemokine expression and release in human vascular endothelial cells in vitro via two distinct signaling pathways. Acta Pharmacol Sin. 2014 Mar;35 (3) :339-50.|[5]M Kouwenberg, et al. Reduced CXCL1 production by endogenous IL-37 expressing dendritic cells does not affect T cell activation. PLoS One. 2021 May 24;16 (5) :e0251809.|[6]Jung-Eun Jang, et al. CXCL1 and its receptor, CXCR2, mediate murine sickle cell vaso-occlusion during hemolytic transfusion reactions. J Clin Invest. 2011 Apr;121 (4) :1397-401.|[7]Yuan Sun, et al. Opioids enhance CXCL1 expression and function after incision in mice. J Pain. 2014 Aug;15 (8) :856-66.