Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XBP1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

X-box binding protein 1

Gene Aliases

XBP2, TREB5, XBP-1, TREB-5

Gene ID

7494

Swiss Prot

P17861

Accession Number

NP_001073007.1

Reactivity

Human, Mouse, Rat

Immunogen

Recombinant funsion protein containing a sequence corresponding to amino acids 1-261 of human XBP1 (NP_005071.2) .

Target

This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum (ER), the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1 (IRE1) . The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1 (S), which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1 (U), is constitutively expressed, and thought to function as a negative feedback regulator of XBP1 (S), which shuts off transcription of target genes during the recovery phase of ER stress. A pseudogene of XBP1 has been identified and localized to chromosome 5.

Clonality

Polyclonal

Conjugation

Unconjugated

Type

Polyclonal Antibody

Sequence

MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN

Applications

WB, IF

Purification

Affinity purified against immunogen

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid// PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)

Reconstitution

Store at -20° C. Avoid repeated freeze/thaw cycles.

Molecular Weight

29 kDa

Fragment

IgG

NCBI Gene Symbol

XBP1

Host or Source

Rabbit

Protein Name

X-box-binding protein 1

Gene Name URL

XBP1

Nucleotide Accession Number

NM_001079539.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP9 (Caspase 9, Caspase-9, CASP-9, ICE-like Apoptotic Protease 6, ICE-LAP6, Apoptotic Protease Mch-6, Apoptotic Protease-activating Factor 3, APAF-3, MCH6) (PE)
MBS6156886-01 0.1 mL

CASP9 (Caspase 9, Caspase-9, CASP-9, ICE-like Apoptotic Protease 6, ICE-LAP6, Apoptotic Protease Mch-6, Apoptotic Protease-activating Factor 3, APAF-3, MCH6) (PE)

Sign In for Pricing
View Details
CASP9 (Caspase 9, Caspase-9, CASP-9, ICE-like Apoptotic Protease 6, ICE-LAP6, Apoptotic Protease Mch-6, Apoptotic Protease-activating Factor 3, APAF-3, MCH6) (PE)
MBS6156886-02 5x 0.1 mL

CASP9 (Caspase 9, Caspase-9, CASP-9, ICE-like Apoptotic Protease 6, ICE-LAP6, Apoptotic Protease Mch-6, Apoptotic Protease-activating Factor 3, APAF-3, MCH6) (PE)

Sign In for Pricing
View Details
NDUFB3 Antibody, Biotin conjugated
A29533-100UG 100 µg

NDUFB3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Monoclonal PAIP2 Antibody (1C12) [DyLight 594]
NBP2-22555DL594 0.1 mL

Mouse Monoclonal PAIP2 Antibody (1C12) [DyLight 594]

Sign In for Pricing
View Details
Recombinant Human CD164 Protein, His, Insect-1mg
QP11305-1mg 1mg

Recombinant Human CD164 Protein, His, Insect-1mg

Sign In for Pricing
View Details
HLA-DR (DR alpha chain, DRB1, DRB4, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen DR alpha chain, HLA DR1B, HLA DR3B, HLA DRA, HLA DRA1, HLA DRB1, HLA DRB3, HLA DRB4, HLA DRB5, HLA-DRA, HLADR4B, HLADRA1, HLADRB, Major histocompatibility complex class II DR alpha, Major histocompatibility complex class II DR beta 1, Major histocompatibility complex class II DR beta 3, Major histocompatibility complex class II DR beta 4, Major histocompatibility complex class II DR beta 5, MHC cell surface glycoprotein, MHC class II antigen DRA) (PE)
168795-AF-PE 100 µL

HLA-DR (DR alpha chain, DRB1, DRB4, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen DR alpha chain, HLA DR1B, HLA DR3B, HLA DRA, HLA DRA1, HLA DRB1, HLA DRB3, HLA DRB4, HLA DRB5, HLA-DRA, HLADR4B, HLADRA1, HLADRB, Major histocompatibility complex class II DR alpha, Major histocompatibility complex class II DR beta 1, Major histocompatibility complex class II DR beta 3, Major histocompatibility complex class II DR beta 4, Major histocompatibility complex class II DR beta 5, MHC cell surface glycoprotein, MHC class II antigen DRA) (PE)

Sign In for Pricing
View Details