What is the catalog number for MESP2 Antibody?

The catalog number for MESP2 Antibody is OAAL00925-100UG.

What sizes are available for MESP2 Antibody?

MESP2 Antibody is available in the following size(s): 100 µg.

Is MESP2 Antibody in stock?

MESP2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

MESP2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Mesoderm posterior bHLH transcription factor 2

Gene Aliases

BHLHc6; class C basic helix-loop-helix protein 6; mesoderm posterior 2 homolog; mesoderm posterior basic helix-loop-helix transcription factor 2; mesoderm posterior protein 2; SCDO2.

Gene ID

145873

Accession Number

https://www.ncbi.nlm.nih.gov/protein/XP_085261

Reactivity

Human, Mouse

Immunogen

MESP2 (XP_085261, 2 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the bHLH family of transcription factors and plays a key role in defining the rostrocaudal patterning of somites via interactions with multiple Notch signaling pathways. This gene is expressed in the anterior presomitic mesoderm and is downregulated immediately after the formation of segmented somites. This gene also plays a role in the formation of epithelial somitic mesoderm and cardiac mesoderm. Mutations in the MESP2 gene cause autosomal recessive spondylocostal dystosis 2 (SCD02) .

Clonality

Monoclonal

Clone

1C8

Type

Monoclonal Antibody

Sequence

AQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETL

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol