Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MESP2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Mesoderm posterior bHLH transcription factor 2

Gene Aliases

BHLHc6; class C basic helix-loop-helix protein 6; mesoderm posterior 2 homolog; mesoderm posterior basic helix-loop-helix transcription factor 2; mesoderm posterior protein 2; SCDO2.

Gene ID

145873

Accession Number

https://www.ncbi.nlm.nih.gov/protein/XP_085261

Reactivity

Human, Mouse

Immunogen

MESP2 (XP_085261, 2 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the bHLH family of transcription factors and plays a key role in defining the rostrocaudal patterning of somites via interactions with multiple Notch signaling pathways. This gene is expressed in the anterior presomitic mesoderm and is downregulated immediately after the formation of segmented somites. This gene also plays a role in the formation of epithelial somitic mesoderm and cardiac mesoderm. Mutations in the MESP2 gene cause autosomal recessive spondylocostal dystosis 2 (SCD02) .

Clonality

Monoclonal

Clone

1C8

Type

Monoclonal Antibody

Sequence

AQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETL

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1 mg/ml

Format

Liquid.// In 1x PBS, pH 7.4

Reconstitution

Store at -20° C or lower. Aliquot to avoid repeated freezing and thawing.

Molecular Weight

26 kDa

Fragment

IgG2a Kappa

NCBI Gene Symbol

MESP2

Host or Source

Mouse

Protein Name

PREDICTED: Homo sapiens mesoderm posterior 2 homolog (mouse) (MESP2), mRNA|PREDICTED: similar to mesoderm posterior 2 [Homo sapiens]

Gene Name URL

MESP2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/XM_085261

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPG21 Antibody; Biotin conjugated
MBS7002099-01 0.05 mg

SPG21 Antibody; Biotin conjugated

Sign In for Pricing
View Details
SPG21 Antibody; Biotin conjugated
MBS7002099-02 0.1 mg

SPG21 Antibody; Biotin conjugated

Sign In for Pricing
View Details
SPG21 Antibody; Biotin conjugated
MBS7002099-03 5x 0.1 mg

SPG21 Antibody; Biotin conjugated

Sign In for Pricing
View Details
DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) APC
MBS6376074-01 0.1 mL

DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) APC

Sign In for Pricing
View Details
DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) APC
MBS6376074-02 5x 0.1 mL

DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) APC

Sign In for Pricing
View Details
DEP Domain Containing 1B (DEPDC1B) Antibody (HRP)
abx335307-01 20 µg

DEP Domain Containing 1B (DEPDC1B) Antibody (HRP)

Sign In for Pricing
View Details