What is the catalog number for ALG12 Antibody?

The catalog number for ALG12 Antibody is OAAL00807-100UG.

What sizes are available for ALG12 Antibody?

ALG12 Antibody is available in the following size(s): 100 µg.

Is ALG12 Antibody in stock?

ALG12 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

ALG12 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

ALG12 alpha-1,6-mannosyltransferase

Gene Aliases

Asparagine-linked glycosylation 12 homolog (S. cerevisiae, alpha-1,6-mannosyltransferase) ; asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase) ; asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog; asparagine-linked glycosylation protein 12 homolog; CDG1G; dolichyl-P-Man:Man (7) GlcNAc (2) -PP-dolichol alpha-1,6-mannosyltransferase; dolichyl-P-Man:Man (7) GlcNAc (2) -PP-dolichyl-alpha-1,6-mannosyltransferase; dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase; dol-P-Man dependent alpha-1,6-mannosyltransferase; dol-P-Man:Man (7) GlcNAc (2) -PP-Dol alpha-1,6-mannosyltransferase; ECM39; hALG12; mannosyltransferase ALG12 homolog; membrane protein SB87; PP14673.

Gene ID

79087

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_077010

Reactivity

Human, Mouse, Rat

Immunogen

ALG12 (NP_077010, 369 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man (7) GlcNAc (2) ) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig) characterized by abnormal N-glycosylation. [provided by RefSeq

Clonality

Monoclonal

Clone

5000

Type

Monoclonal Antibody

Sequence

NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol