Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX54 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

DEAD-box helicase 54

Gene Aliases

Apoptosis related protein 5; ATP-dependent RNA helicase DDX54; ATP-dependent RNA helicase DP97; DEAD (Asp-Glu-Ala-Asp) box polypeptide 54; DEAD box helicase 97 KDa; DEAD box polypeptide, 97kD; DEAD box protein 54; DEAD box RNA helicase 97 kDa; DP97.

Gene ID

79039

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_076977

Reactivity

Human, Mouse

Immunogen

DDX54 (NP_076977, 778 a.a. ~ 881 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene. [provided by RefSeq

Clonality

Monoclonal

Clone

20000

Type

Monoclonal Antibody

Sequence

DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM

Applications

Enzyme-linked immunosorbent assay|Immunohistochemistry-Paraffin|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

DDX54

Host or Source

Mouse

Protein Name

ATP-dependent RNA helicase DDX54 isoform 2 [Homo sapiens]|Homo sapiens DEAD-box helicase 54 (DDX54), transcript variant 2, mRNA

Gene Name URL

DDX54

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_024072

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYB5R3 Rabbit Polyclonal Antibody
AP20483PU-N 100 µg

CYB5R3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Canine Soluble interleukin 7 receptor ELISA Kit
MBS746610-01 48 Well

Canine Soluble interleukin 7 receptor ELISA Kit

Sign In for Pricing
View Details
Canine Soluble interleukin 7 receptor ELISA Kit
MBS746610-02 96 Well

Canine Soluble interleukin 7 receptor ELISA Kit

Sign In for Pricing
View Details
Canine Soluble interleukin 7 receptor ELISA Kit
MBS746610-03 5x 96 Well

Canine Soluble interleukin 7 receptor ELISA Kit

Sign In for Pricing
View Details
Canine Soluble interleukin 7 receptor ELISA Kit
MBS746610-04 10x 96 Well

Canine Soluble interleukin 7 receptor ELISA Kit

Sign In for Pricing
View Details
Active Ornithine Decarboxylase (ODC)
SBPB223Hu02-01 10 µg

Active Ornithine Decarboxylase (ODC)

Sign In for Pricing
View Details