Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSKS Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Testis specific serine kinase substrate

Gene Aliases

PPP1R161; protein phosphatase 1, regulatory subunit 161; STK22 substrate 1; STK22S1; testis specific serine/threonine kinase substrate; testis-specific kinase substrate; testis-specific serine kinase substrate; TSKS1; TSSKS.

Gene ID

60385

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_068379

Reactivity

Human, Mouse

Immunogen

TSKS (NP_068379, 471 a.a. ~ 560 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression. [provided by RefSeq

Clonality

Monoclonal

Clone

2000000000

Type

Monoclonal Antibody

Sequence

ALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDH

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

TSKS

Host or Source

Mouse

Protein Name

Homo sapiens testis specific serine kinase substrate (TSKS), mRNA|testis-specific serine kinase substrate [Homo sapiens]

Gene Name URL

TSKS

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_021733

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tm7sf3 shRNA (UAS) - Lentiviral mouse Tm7sf3 shRNA (UAS, RFP) (25)
GTR15147275 1 Vial

Lentiviral mouse Tm7sf3 shRNA (UAS) - Lentiviral mouse Tm7sf3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)
MBS2049253-01 0.1 mL

PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)
MBS2049253-02 0.2 mL

PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)
MBS2049253-03 0.5 mL

PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)
MBS2049253-04 1 mL

PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)
MBS2049253-05 5 mL

PE-Linked Polyclonal Antibody to Surfactant Associated Protein A (SPA)

Sign In for Pricing
View Details