Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MS4A7 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Membrane spanning 4-domains A7

Gene Aliases

4SPAN2; CD20 antigen-like 4; CD20/Fc-epsilon-RI-beta family member 4; CD20L4; CFFM4; four-span transmembrane protein 2; high affinity immunoglobulin epsilon receptor beta subunit; membrane-spanning 4-domains subfamily A member 7; MS4A8.

Gene ID

58475

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH20673

Reactivity

Human, Mouse

Immunogen

MS4A7 (AAH20673, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq

Clonality

Monoclonal

Clone

2D3

Type

Monoclonal Antibody

Sequence

MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

MS4A7

Host or Source

Mouse

Protein Name

Homo sapiens membrane-spanning 4-domains, subfamily A, member 7, mRNA (cDNA clone MGC:22368 IMAGE:4720044), complete cds|Membrane-spanning 4-domains, subfamily A, member 7 [Homo sapiens]

Gene Name URL

MS4A7

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC020673

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Interleukin 1 Alpha (IL1a)
RPU54450-01 50 µg

Recombinant Bovine Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
Recombinant Bovine Interleukin 1 Alpha (IL1a)
RPU54450-02 100 µg

Recombinant Bovine Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
Recombinant Bovine Interleukin 1 Alpha (IL1a)
RPU54450-03 1 mg

Recombinant Bovine Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
Gtf2a2 (NM_053345) Rat Untagged Clone
RN209035 10 µg

Gtf2a2 (NM_053345) Rat Untagged Clone

Sign In for Pricing
View Details
LDLRAD2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1206103 1.0 µg DNA

LDLRAD2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Trp53 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
48496154 3x 1.0 µg DNA

Trp53 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details