Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHGA10 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Protocadherin gamma subfamily A, 10

Gene Aliases

PCDH-GAMMA-A10; protocadherin gamma-A10.

Gene ID

56106

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_061736.1

Reactivity

Human, Mouse

Immunogen

PCDHGA10 (NP_061736.1, 219 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. [provided by RefSeq

Clonality

Monoclonal

Clone

3A7

Type

Monoclonal Antibody

Sequence

SDGGDPLRSGTVLVSVTVFDANDNAPVFTLPEYRVSVPENLPVGTQLLTVTATDRDEGANGEVTYSFRKLPDTQLLKFQLNKYTGEIKISENLDYEET

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

PCDHGA10

Host or Source

Mouse

Protein Name

Homo sapiens protocadherin gamma subfamily A, 10 (PCDHGA10), transcript variant 1, mRNA|protocadherin gamma-A10 isoform 1 precursor [Homo sapiens]

Gene Name URL

PCDHGA10

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_018913

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal EEF1G Antibody (3F11-1A10)
H00001937-M01 0.1 mg

Mouse Monoclonal EEF1G Antibody (3F11-1A10)

Sign In for Pricing
View Details
Integrin Alpha-M (ITGAM) Antibody
abx421136-01 50 µg

Integrin Alpha-M (ITGAM) Antibody

Sign In for Pricing
View Details
Integrin Alpha-M (ITGAM) Antibody
abx421136-02 100 µg

Integrin Alpha-M (ITGAM) Antibody

Sign In for Pricing
View Details
TET2 Antibody
E91526 100 µL

TET2 Antibody

Sign In for Pricing
View Details
Anti-RAB1B Antibody Picoband®, Dylight594 Conjugate
A04589-1-Dylight594 100 µg

Anti-RAB1B Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-221-5p Vector
mh30355 500 ng

LentimiRa-Off-hsa-miR-221-5p Vector

Sign In for Pricing
View Details