Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHGC5 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Protocadherin gamma subfamily C, 5

Gene Aliases

PCDH-GAMMA-C5; protocadherin gamma-C5.

Gene ID

56097

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_061752

Reactivity

Human, Mouse

Immunogen

PCDHGC5 (NP_061752, 467 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. [provided by RefSeq

Clonality

Monoclonal

Clone

3A6

Type

Monoclonal Antibody

Sequence

RPPGSLLCTVAASDPDTGDNARLTYSIVGNQVQGAPASSFVYVNPEDGRIFAQRTFDYELLQMLQIVVGVRDSGSPPLHANTSLHVFVLDENDNAPAVLHPRPDWEHSA

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

PCDHGC5

Host or Source

Mouse

Protein Name

Homo sapiens protocadherin gamma subfamily C, 5 (PCDHGC5), transcript variant 1, mRNA|protocadherin gamma-C5 isoform 1 precursor [Homo sapiens]

Gene Name URL

PCDHGC5

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_018929

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thymidine kinase 1 Recombinant Protein C-6 His Tag 50UG
IHUTKK1RC6HIS50UG 50 µg

Human Thymidine kinase 1 Recombinant Protein C-6 His Tag 50UG

Sign In for Pricing
View Details
Human CL-P1/COLEC12 (NP_569057) VersaClone cDNA
RDC2951 10 µg

Human CL-P1/COLEC12 (NP_569057) VersaClone cDNA

Sign In for Pricing
View Details
Rabbit Polyclonal ERF Antibody [DyLight 680]
NB100-88120FR 0.1 mL

Rabbit Polyclonal ERF Antibody [DyLight 680]

Sign In for Pricing
View Details
Recombinant Human THAP domain-containing protein 11(THAP11), partial
AP71456-01 20 µg

Recombinant Human THAP domain-containing protein 11(THAP11), partial

Sign In for Pricing
View Details
Recombinant Human THAP domain-containing protein 11(THAP11), partial
AP71456-02 100 µg

Recombinant Human THAP domain-containing protein 11(THAP11), partial

Sign In for Pricing
View Details
Recombinant Human THAP domain-containing protein 11(THAP11), partial
AP71456-03 1 mg

Recombinant Human THAP domain-containing protein 11(THAP11), partial

Sign In for Pricing
View Details