Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3K Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

RNA polymerase III subunit K

Gene Aliases

C11; C11-RNP3; DNA-directed RNA polymerase III subunit K; DNA-directed RNA polymerase III subunit RPC10; DNA-directed RNA polymerases III 12.5 kDa polypeptide; HLD21; My010; polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; polymerase (RNA) III subunit K; RNA polymerase III 12.5 kDa subunit; RNA polymerase III subunit C10; RNA polymerase III subunit C11; RNA polymerase III subunit CII; RPC10; RPC11; RPC12.5.

Gene ID

51728

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH11932

Reactivity

Human, Mouse

Immunogen

POLR3K (AAH11932, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. [provided by RefSeq

Clonality

Monoclonal

Clone

3F5

Type

Monoclonal Antibody

Sequence

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

POLR3K

Host or Source

Mouse

Protein Name

Homo sapiens polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa, mRNA (cDNA clone MGC:19933 IMAGE:4303428), complete cds|Polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa [Homo sapiens]

Gene Name URL

POLR3K

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC011932

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5 Recombinant Antibody
RAC07828-01 50 µL

C5 Recombinant Antibody

Sign In for Pricing
View Details
C5 Recombinant Antibody
RAC07828-02 100 µL

C5 Recombinant Antibody

Sign In for Pricing
View Details
Porcine Tumour necrosis factor related weak inducer of apoptosis ELISA Kit
MBS742453-01 48 Well

Porcine Tumour necrosis factor related weak inducer of apoptosis ELISA Kit

Sign In for Pricing
View Details
Porcine Tumour necrosis factor related weak inducer of apoptosis ELISA Kit
MBS742453-02 96 Well

Porcine Tumour necrosis factor related weak inducer of apoptosis ELISA Kit

Sign In for Pricing
View Details
Porcine Tumour necrosis factor related weak inducer of apoptosis ELISA Kit
MBS742453-03 5x 96 Well

Porcine Tumour necrosis factor related weak inducer of apoptosis ELISA Kit

Sign In for Pricing
View Details
Porcine Tumour necrosis factor related weak inducer of apoptosis ELISA Kit
MBS742453-04 10x 96 Well

Porcine Tumour necrosis factor related weak inducer of apoptosis ELISA Kit

Sign In for Pricing
View Details