Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM33 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Tripartite motif containing 33

Gene Aliases

E3 ubiquitin-protein ligase TRIM33; ECTO; ectodermin homolog; protein Rfg7; PTC7; RET-fused gene 7 protein; RFG7; RING-type E3 ubiquitin transferase TRIM33; TF1G; TIF1G; TIF1-gamma; TIF1GAMMA; TIFGAMMA; transcriptional intermediary factor 1 gamma.

Gene ID

51592

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_056990

Reactivity

Human, Mouse

Immunogen

TRIM33 (NP_056990, 1006 a.a. ~ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. [provided by RefSeq

Clonality

Monoclonal

Clone

6F4

Type

Monoclonal Antibody

Sequence

VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

TRIM33

Host or Source

Mouse

Protein Name

E3 ubiquitin-protein ligase TRIM33 isoform alpha [Homo sapiens]|Homo sapiens tripartite motif containing 33 (TRIM33), transcript variant a, mRNA

Gene Name URL

TRIM33

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_015906

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human Musashi homolog 2 (MSI2) (MSI2- phospho) IgG (aff pure)
AB-23053-A 100 µg

Rabbit Anti-Human Musashi homolog 2 (MSI2) (MSI2- phospho) IgG (aff pure)

Sign In for Pricing
View Details
CANT1 (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY) (PE)
124311-PE 100 µL

CANT1 (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY) (PE)

Sign In for Pricing
View Details
ZNF791 Antibody - middle region : Biotin (ARP39955_P050-Biotin)
ARP39955_P050-Biotin 100 µL

ZNF791 Antibody - middle region : Biotin (ARP39955_P050-Biotin)

Sign In for Pricing
View Details
RPL24 293 Cell Lysate
410082 0.1 mg

RPL24 293 Cell Lysate

Sign In for Pricing
View Details
Methyl 5-hydroxynicotinate, HCl
455729-01 100 mg

Methyl 5-hydroxynicotinate, HCl

Sign In for Pricing
View Details
Methyl 5-hydroxynicotinate, HCl
455729-02 250 mg

Methyl 5-hydroxynicotinate, HCl

Sign In for Pricing
View Details