Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT6 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Sirtuin 6

Gene Aliases

NAD-dependent protein deacetylase sirtuin-6; regulatory protein SIR2 homolog 6; SIR2L6; SIR2-like protein 6; sir2-related protein type 6; sirtuin type 6.

Gene ID

51548

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_057623.1

Reactivity

Human, Mouse

Immunogen

SIRT6 (NP_057623.1, 141 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family. [provided by RefSeq

Clonality

Monoclonal

Clone

1D8

Type

Monoclonal Antibody

Sequence

CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHA

Applications

Enzyme-linked immunosorbent assay

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

SIRT6

Host or Source

Mouse

Protein Name

Homo sapiens sirtuin 6 (SIRT6), transcript variant 1, mRNA|NAD-dependent protein deacetylase sirtuin-6 isoform 1 [Homo sapiens]

Gene Name URL

SIRT6

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_016539

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Afadin/AF-6 Antibody
NBP2-55781 100 µL

Rabbit Polyclonal Afadin/AF-6 Antibody

Sign In for Pricing
View Details
GPR31 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
22554111 3x 1.0 µg

GPR31 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Gipc2 (NM_016867) Mouse Recombinant Protein
PM47371M5 20 µg

Gipc2 (NM_016867) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human S100A7 / Protein S100-A7 Recombinant Protein
R1484h 1 Each

Human S100A7 / Protein S100-A7 Recombinant Protein

Sign In for Pricing
View Details
CAMK1D Protein Lysate
OCOA19765-20UG 20 µg

CAMK1D Protein Lysate

Sign In for Pricing
View Details
HLA-B, ID (HLA-B, HLAB, HLA class I histocompatibility antigen, B-7 alpha chain, MHC class I antigen B*7) (MaxLight 650)
MBS6307041-01 0.1 mL

HLA-B, ID (HLA-B, HLAB, HLA class I histocompatibility antigen, B-7 alpha chain, MHC class I antigen B*7) (MaxLight 650)

Sign In for Pricing
View Details