Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIB2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Tribbles pseudokinase 2

Gene Aliases

C5FW; GS3955; TRB2; tribbles homolog 2.

Gene ID

28951

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH02637

Reactivity

Human, Mouse

Immunogen

TRIB2 (AAH02637, 1 a.a. ~ 343 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq

Clonality

Monoclonal

Clone

1D11

Type

Monoclonal Antibody

Sequence

MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

Applications

Enzyme-linked immunosorbent assay|Immunoprecipitation|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

TRIB2

Host or Source

Mouse

Protein Name

Homo sapiens tribbles homolog 2 (Drosophila), mRNA (cDNA clone MGC:3860 IMAGE:3607549), complete cds|Tribbles homolog 2 (Drosophila) [Homo sapiens]

Gene Name URL

TRIB2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC002637

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DNA Antibody (DSD/958) [Janelia Fluor 646]
NBP3-11590JF646 0.1 mL

Mouse Monoclonal DNA Antibody (DSD/958) [Janelia Fluor 646]

Sign In for Pricing
View Details
Human Carbonic Anhydrase 9 (CA9) ELISA Kit
MBS7235028-01 48 Well

Human Carbonic Anhydrase 9 (CA9) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic Anhydrase 9 (CA9) ELISA Kit
MBS7235028-02 96 Well

Human Carbonic Anhydrase 9 (CA9) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic Anhydrase 9 (CA9) ELISA Kit
MBS7235028-03 5x 96 Well

Human Carbonic Anhydrase 9 (CA9) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic Anhydrase 9 (CA9) ELISA Kit
MBS7235028-04 10x 96 Well

Human Carbonic Anhydrase 9 (CA9) ELISA Kit

Sign In for Pricing
View Details
MERTK (phospho-Tyr753/685) Antibody
E013320 100 µg -100 µL

MERTK (phospho-Tyr753/685) Antibody

Sign In for Pricing
View Details