What is the catalog number for PPP2R3B Antibody?

The catalog number for PPP2R3B Antibody is OAAL00648-100UG.

What sizes are available for PPP2R3B Antibody?

PPP2R3B Antibody is available in the following size(s): 100 µg.

Is PPP2R3B Antibody in stock?

PPP2R3B Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

PPP2R3B Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein phosphatase 2 regulatory subunit B''beta

Gene Aliases

NYREN8; NY-REN-8 antigen; PPP2R3L; PPP2R3LY; PR48; PR70; protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta; protein phosphatase 2, regulatory subunit B'', beta; serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B; serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta.

Gene ID

28227

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH11180

Reactivity

Human, Mouse

Immunogen

PPP2R3B (AAH11180, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Clonality

Monoclonal

Clone

2000000000000

Type

Monoclonal Antibody

Sequence

MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunoprecipitation|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

PPP2R3B

Host or Source

Mouse

Protein Name

Homo sapiens protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta, mRNA (cDNA clone IMAGE:4150858), partial cds|PPP2R3B protein, partial [Homo sapiens]