What is the catalog number for APOBEC3C Antibody?

The catalog number for APOBEC3C Antibody is OAAL00647-100UG.

What sizes are available for APOBEC3C Antibody?

APOBEC3C Antibody is available in the following size(s): 100 µg.

Is APOBEC3C Antibody in stock?

APOBEC3C Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

APOBEC3C Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Apolipoprotein B mRNA editing enzyme catalytic subunit 3C

Gene Aliases

A3C; APOBEC1L; apolipoprotein B editing enzyme catalytic polypeptide-like 3C; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C; ARDC2; ARDC4; ARP5; bK150C2.3; DNA dC->dU-editing enzyme APOBEC-3C; PBI; phorbolin I; probable DNA dC->dU-editing enzyme APOBEC-3C.

Gene ID

27350

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_055323

Reactivity

Human, Mouse

Immunogen

APOBEC3C (NP_055323, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. [provided by RefSeq

Clonality

Monoclonal

Clone

3000000

Type

Monoclonal Antibody

Sequence

YTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ

Applications

Enzyme-linked immunosorbent assay|Immunoprecipitation

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol