Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHDH Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Dihydrodiol dehydrogenase

Gene Aliases

2DD;3-deoxyglucosone reductase; dihydrodiol dehydrogenase (dimeric) ; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; HUM2DD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase.

Gene ID

27294

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_055290

Reactivity

Human, Mouse

Immunogen

DHDH (NP_055290, 235 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction. [provided by RefSeq

Clonality

Monoclonal

Clone

3A11

Type

Monoclonal Antibody

Sequence

SNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

DHDH

Host or Source

Mouse

Protein Name

Homo sapiens dihydrodiol dehydrogenase (DHDH), mRNA|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase [Homo sapiens]

Gene Name URL

DHDH

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_014475

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgM (Immunoglobulin Mu Heavy Chain, AGM1, IGHM, Constant Region of Heavy Chain of IgM, Ig Mu Chain C Region) (APC)
MBS6123331-01 0.1 mL

IgM (Immunoglobulin Mu Heavy Chain, AGM1, IGHM, Constant Region of Heavy Chain of IgM, Ig Mu Chain C Region) (APC)

Sign In for Pricing
View Details
IgM (Immunoglobulin Mu Heavy Chain, AGM1, IGHM, Constant Region of Heavy Chain of IgM, Ig Mu Chain C Region) (APC)
MBS6123331-02 5x 0.1 mL

IgM (Immunoglobulin Mu Heavy Chain, AGM1, IGHM, Constant Region of Heavy Chain of IgM, Ig Mu Chain C Region) (APC)

Sign In for Pricing
View Details
GPR103 Double Nickase Plasmid (m2)
sc-432842-NIC-2 20 µg

GPR103 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Nori® Camel Haptoglobin ELISA Kit
GR242063 96 Well

Nori® Camel Haptoglobin ELISA Kit

Sign In for Pricing
View Details
Znf260 (Zinc Finger Protein 260, Zfp-260, Znf260, Zfp260) (MaxLight 550) discontinued
302871-ML550 100 µL

Znf260 (Zinc Finger Protein 260, Zfp-260, Znf260, Zfp260) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Staphylococcus Enterotoxin B antibody, PerCP-Cy5.5 Conjugated
bs-10722R-PerCP-Cy5.5 100 µL

Staphylococcus Enterotoxin B antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details