What is the catalog number for LSM1 Antibody?

The catalog number for LSM1 Antibody is OAAL00644-100UG.

What sizes are available for LSM1 Antibody?

LSM1 Antibody is available in the following size(s): 100 µg.

Is LSM1 Antibody in stock?

LSM1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

LSM1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

LSM1 homolog, mRNA degradation associated

Gene Aliases

Cancer-associated Sm protein; cancer-associated Sm-like protein; CASM; LSM1 homolog, U6 small nuclear RNA associated; LSM1 mRNA degradation associated; LSM1, U6 small nuclear RNA associated; LSM1-like protein U6 small nuclear RNA associated; small nuclear ribonuclear CaSm; U6 snRNA-associated Sm-like protein LSm1; YJL124C.

Gene ID

27257

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_055277.1

Reactivity

Human, Mouse

Immunogen

LSM1 (NP_055277.1, 34 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061) . Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM

Clonality

Monoclonal

Clone

4F7

Type

Monoclonal Antibody

Sequence

SIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol