Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDOC1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

LDOC1 regulator of NFKB signaling

Gene Aliases

BCUR1; breast cancer, up-regulated 1; leucine zipper downregulated in cancer; leucine zipper down-regulated in cancer 1; leucine zipper protein down-regulated in cancer cells; mammalian retrotransposon-derived 7; Mar7; Mart7; protein LDOC1; retrotransposon Gag like 7; RTL7; SIRH7; Sushi-Ichi retrotransposon homolog 7.

Gene ID

23641

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_036449.1

Reactivity

Human, Mouse

Immunogen

LDOC1 (NP_036449.1, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB) . The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq

Clonality

Monoclonal

Clone

300000

Type

Monoclonal Antibody

Sequence

MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

LDOC1

Host or Source

Mouse

Protein Name

Homo sapiens LDOC1, regulator of NFKB signaling (LDOC1), mRNA|protein LDOC1 [Homo sapiens]

Gene Name URL

LDOC1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_012317.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ihh (NM_053384) Rat Tagged Lenti ORF Clone
RR207510L3 10 µg

Ihh (NM_053384) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tyramide Signal Amplification Kit (TRAMA Labeling)
G4871-01 20 Tests

Tyramide Signal Amplification Kit (TRAMA Labeling)

Sign In for Pricing
View Details
Tyramide Signal Amplification Kit (TRAMA Labeling)
G4871-02 50 Tests

Tyramide Signal Amplification Kit (TRAMA Labeling)

Sign In for Pricing
View Details
IKK alpha Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-2907R-BF680-TR 20 µL

IKK alpha Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Src Inhibitor 1
orb1223231-01 1 g

Src Inhibitor 1

Sign In for Pricing
View Details
Src Inhibitor 1
orb1223231-02 2 mg

Src Inhibitor 1

Sign In for Pricing
View Details