Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAP2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

ArfGAP with coiled-coil, ankyrin repeat and PH domains 2

Gene Aliases

Arf GAP with coiled coil, ANK repeat and PH domains 2; arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2; centaurin-beta-2; CENTB2; CNT-B2.

Gene ID

23527

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_036419

Reactivity

Human, Mouse

Immunogen

CENTB2 (NP_036419, 473 a.a. ~ 581 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Clonality

Monoclonal

Clone

4G3

Type

Monoclonal Antibody

Sequence

DVINRVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVS

Applications

Enzyme-linked immunosorbent assay|Immunoprecipitation|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

ACAP2

Host or Source

Mouse

Protein Name

Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 [Homo sapiens]|Homo sapiens ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 (ACAP2), mRNA

Gene Name URL

ACAP2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_012287

More Discoveries

Explore Other Products

Browse additional items from our catalog

High Affinity Immunoglobulin Gamma Fc Receptor I / CD64 (FCGR1) Antibody
abx455018-01 50 µg

High Affinity Immunoglobulin Gamma Fc Receptor I / CD64 (FCGR1) Antibody

Sign In for Pricing
View Details
High Affinity Immunoglobulin Gamma Fc Receptor I / CD64 (FCGR1) Antibody
abx455018-02 100 µg

High Affinity Immunoglobulin Gamma Fc Receptor I / CD64 (FCGR1) Antibody

Sign In for Pricing
View Details
Human NASP knockout cell line
ABC-KH9857 1 Vial

Human NASP knockout cell line

Sign In for Pricing
View Details
PPIAL4A, ID (PPIAL4A, COAS2, Peptidyl-prolyl cis-trans isomerase A-like 4A/B/C, Chromosome 1-amplified sequence 2, Cyclophilin homolog overexpressed in liver cancer) (MaxLight 490)
MBS6336242-01 0.1 mL

PPIAL4A, ID (PPIAL4A, COAS2, Peptidyl-prolyl cis-trans isomerase A-like 4A/B/C, Chromosome 1-amplified sequence 2, Cyclophilin homolog overexpressed in liver cancer) (MaxLight 490)

Sign In for Pricing
View Details
PPIAL4A, ID (PPIAL4A, COAS2, Peptidyl-prolyl cis-trans isomerase A-like 4A/B/C, Chromosome 1-amplified sequence 2, Cyclophilin homolog overexpressed in liver cancer) (MaxLight 490)
MBS6336242-02 5x 0.1 mL

PPIAL4A, ID (PPIAL4A, COAS2, Peptidyl-prolyl cis-trans isomerase A-like 4A/B/C, Chromosome 1-amplified sequence 2, Cyclophilin homolog overexpressed in liver cancer) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Nothoprocta perdicaria Cytochrome c oxidase subunit 2 (MT-CO2)
orb2929461-01 20 µg

Recombinant Nothoprocta perdicaria Cytochrome c oxidase subunit 2 (MT-CO2)

Sign In for Pricing
View Details