Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISCU Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Iron-sulfur cluster assembly enzyme

Gene Aliases

2310020H20Rik; HML; hnifU; iron-sulfur cluster assembly enzyme ISCU, mitochondrial; IscU iron-sulfur cluster scaffold homolog; ISU2; NIFU; nifU-like N-terminal domain-containing protein; NIFUN.

Gene ID

23479

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH11906

Reactivity

Human, Mouse

Immunogen

NIFUN (AAH11906, 26 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria. [provided by RefSeq

Clonality

Monoclonal

Clone

3B8-1C4

Type

Monoclonal Antibody

Sequence

RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 kappa

NCBI Gene Symbol

ISCU

Host or Source

Mouse

Protein Name

Homo sapiens iron-sulfur cluster scaffold homolog (E. coli), mRNA (cDNA clone MGC:20315 IMAGE:4136262), complete cds|Iron-sulfur cluster scaffold homolog (E. coli) [Homo sapiens]

Gene Name URL

ISCU

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC011906

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMCD1 (LIM and cysteine-rich Domains Protein 1, Dyxin, LMCD1) (MaxLight 405) discontinued
302532-ML405 100 µL

LMCD1 (LIM and cysteine-rich Domains Protein 1, Dyxin, LMCD1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-VPAC2/VIPR2 Antibody Picoband® Fluoro647 Conjugated
A03768-1-Fluoro647 100 µg/Vial

Anti-VPAC2/VIPR2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Satb2 shRNA (UAS) - Lentiviral mouseSatb2 shRNA (UAS, GFP) (25)
GTR15228920 1 Vial

Lentiviral mouse Satb2 shRNA (UAS) - Lentiviral mouseSatb2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
CLVS2 Protein Lysate
OCOA16515-20UG 20 µg

CLVS2 Protein Lysate

Sign In for Pricing
View Details
Rat FABP3-Fatty Acid Binding Protein 3, Muscle and Heart- ELISA Kit
E-EL-R0871-01 24 Tests

Rat FABP3-Fatty Acid Binding Protein 3, Muscle and Heart- ELISA Kit

Sign In for Pricing
View Details
Rat FABP3-Fatty Acid Binding Protein 3, Muscle and Heart- ELISA Kit
E-EL-R0871-02 48 Tests

Rat FABP3-Fatty Acid Binding Protein 3, Muscle and Heart- ELISA Kit

Sign In for Pricing
View Details