What is the catalog number for CD93 Antibody?

The catalog number for CD93 Antibody is OAAL00582-100UG.

What sizes are available for CD93 Antibody?

CD93 Antibody is available in the following size(s): 100 µg.

Is CD93 Antibody in stock?

CD93 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

CD93 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

CD93 molecule

Gene Aliases

C1q receptor 1; C1q/MBL/SPA receptor; C1qR; C1qR (P) ; C1QR1; C1qRP; CD93 antigen; CDw93; complement component 1 q subcomponent receptor 1; complement component C1q receptor; dJ737E23.1; ECSM3; matrix-remodeling-associated protein 4; matrix-remodelling associated 4; MXRA4.

Gene ID

22918

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_036204

Reactivity

Human, Mouse

Immunogen

CD93 (NP_036204, 33 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq

Clonality

Monoclonal

Clone

3D12

Type

Monoclonal Antibody

Sequence

GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol