Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD93 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

CD93 molecule

Gene Aliases

C1q receptor 1; C1q/MBL/SPA receptor; C1qR; C1qR (P) ; C1QR1; C1qRP; CD93 antigen; CDw93; complement component 1 q subcomponent receptor 1; complement component C1q receptor; dJ737E23.1; ECSM3; matrix-remodeling-associated protein 4; matrix-remodelling associated 4; MXRA4.

Gene ID

22918

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_036204

Reactivity

Human, Mouse

Immunogen

CD93 (NP_036204, 33 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq

Clonality

Monoclonal

Clone

3D12

Type

Monoclonal Antibody

Sequence

GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG3 Lambda

NCBI Gene Symbol

CD93

Host or Source

Mouse

Protein Name

Complement component C1q receptor precursor [Homo sapiens]|Homo sapiens CD93 molecule (CD93), mRNA

Gene Name URL

CD93

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_012072

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thymosin Beta 10 (TMSb10) ELISA Kit
EKL61109 96 Tests

Human Thymosin Beta 10 (TMSb10) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Lipoprotein
GTR10451251 96 Well

Guinea Pig Lipoprotein

Sign In for Pricing
View Details
Magic™ Membrane Protein Human ADORA2A (Adenosine A2a receptorperoxisome proliferator activated receptor gamma)
MP0037F Each

Magic™ Membrane Protein Human ADORA2A (Adenosine A2a receptorperoxisome proliferator activated receptor gamma)

Sign In for Pricing
View Details
GAS1 Peptide - C-terminal region (AAP73867)
AAP73867-100UG 100 µg

GAS1 Peptide - C-terminal region (AAP73867)

Sign In for Pricing
View Details
Mouse Monoclonal Defensin alpha 5 Antibody (8C8) [FITC]
NB110-60002F 0.1 mL

Mouse Monoclonal Defensin alpha 5 Antibody (8C8) [FITC]

Sign In for Pricing
View Details
Mouse Monoclonal LENG1 Antibody (OTI10A7) [DyLight 405]
NBP2-72202V 0.1 mL

Mouse Monoclonal LENG1 Antibody (OTI10A7) [DyLight 405]

Sign In for Pricing
View Details