Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1L Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

General transcription factor IIA subunit 1 like

Gene Aliases

ALF; general transcription factor II A, 1-like factor; general transcription factor IIA 1-like; GTF2A1-like factor; testis secretory sperm-binding protein Li 230m; TFIIA-alpha and beta-like factor; TFIIA-alpha/beta-like factor.

Gene ID

11036

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_006863

Reactivity

Human, Mouse

Immunogen

ALF (NP_006863, 251 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq

Clonality

Monoclonal

Clone

2000

Type

Monoclonal Antibody

Sequence

PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQ

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunoprecipitation|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

GTF2A1L

Host or Source

Mouse

Protein Name

Homo sapiens general transcription factor IIA subunit 1 like (GTF2A1L), transcript variant 1, mRNA|TFIIA-alpha and beta-like factor isoform 1 [Homo sapiens]

Gene Name URL

GTF2A1L

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_006872

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal integrin beta 4 binding protein Antibody
NBP1-52641 100 µL

Rabbit Polyclonal integrin beta 4 binding protein Antibody

Sign In for Pricing
View Details
KLK2 Peptide
45-808P 0.1 mg

KLK2 Peptide

Sign In for Pricing
View Details
BTN3A2 CRISPR Knock Out 293T Cell Line (Human)
13565141 1x 10^6 Cells / 1.0 mL

BTN3A2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal NDFIP1 Antibody [Alexa Fluor 700]
NBP2-82012AF700 0.1 mL

Rabbit Polyclonal NDFIP1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Rat Procollagen Type III (Pro-COL3) ELISA Kit
abx255898-01 96 Tests

Rat Procollagen Type III (Pro-COL3) ELISA Kit

Sign In for Pricing
View Details
Rat Procollagen Type III (Pro-COL3) ELISA Kit
abx255898-02 5x 96 Tests

Rat Procollagen Type III (Pro-COL3) ELISA Kit

Sign In for Pricing
View Details