Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WASF2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

WASP family member 2

Gene Aliases

DJ393P12.2; IMD2; protein WAVE-2; putative Wiskott-Aldrich syndrome protein family member 4; SCAR2; suppressor of cyclic-AMP receptor (WASP-family) ; verprolin homology domain-containing protein 2; WAS protein family member 2; WASF4; WASP family protein member 2; WASP family protein member 4; WASP family Verprolin-homologous protein 2; WAVE2; wiskott-Aldrich syndrome protein family member 2.

Gene ID

10163

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_008921

Reactivity

Human, Mouse

Immunogen

WASF2 (NP_008921, 73 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. [provided by RefSeq

Clonality

Monoclonal

Clone

1F7

Type

Monoclonal Antibody

Sequence

DRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

WASF2

Host or Source

Mouse

Protein Name

Homo sapiens WAS protein family member 2 (WASF2), transcript variant 1, mRNA|wiskott-Aldrich syndrome protein family member 2 isoform 1 [Homo sapiens]

Gene Name URL

WASF2

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_006990

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX5 Antibody
MBS7136571-01 0.05 mL

DDX5 Antibody

Sign In for Pricing
View Details
DDX5 Antibody
MBS7136571-02 0.1 mL

DDX5 Antibody

Sign In for Pricing
View Details
DDX5 Antibody
MBS7136571-03 5x 0.1 mL

DDX5 Antibody

Sign In for Pricing
View Details
Wdr12 3'UTR Luciferase Stable Cell Line
TU122209 1.0 mL

Wdr12 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Fibromodulin (FMOD) ELISA Kit
RD-FMOD-Ra-48Tests 48 Tests

Rat Fibromodulin (FMOD) ELISA Kit

Sign In for Pricing
View Details
Octoclothepin maleate salt
574828 25.0mg

Octoclothepin maleate salt

Sign In for Pricing
View Details