What is the catalog number for RNF40 Antibody?

The catalog number for RNF40 Antibody is OAAL00477-100UG.

What sizes are available for RNF40 Antibody?

RNF40 Antibody is available in the following size(s): 100 µg.

Is RNF40 Antibody in stock?

RNF40 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

RNF40 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Ring finger protein 40

Gene Aliases

95 kDa retinoblastoma protein binding protein;95 kDa retinoblastoma-associated protein; BRE1 E3 ubiquitin ligase homolog B; BRE1B; BRE1-B; E3 ubiquitin-protein ligase BRE1B; Rb-associated protein; RBP95; ring finger protein 40, E3 ubiquitin protein ligase; RING-type E3 ubiquitin transferase BRE1B; STARING.

Gene ID

9810

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_055586

Reactivity

Human, Mouse

Immunogen

RNF40 (NP_055586, 102 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. [provided by RefSeq

Clonality

Monoclonal

Clone

1C1

Type

Monoclonal Antibody

Sequence

DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol