Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOS1AP Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Nitric oxide synthase 1 adaptor protein

Gene Aliases

6330408P19Rik; CAPON; carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein; C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON) ; C-terminal PDZ ligand of neuronal nitric oxide synthase protein; ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain; nitric oxide synthase 1 (neuronal) adaptor protein; NPHS22.

Gene ID

9722

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_055512.1

Reactivity

Human, Mouse

Immunogen

NOS1AP (NP_055512.1, 99 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS) . This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Clonality

Monoclonal

Clone

3B11

Type

Monoclonal Antibody

Sequence

WTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQL

Applications

Enzyme-linked immunosorbent assay

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

NOS1AP

Host or Source

Mouse

Protein Name

Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein isoform 1 [Homo sapiens]|Homo sapiens nitric oxide synthase 1 adaptor protein (NOS1AP), transcript variant 1, mRNA

Gene Name URL

NOS1AP

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_014697

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rfxap Antibody - middle region : HRP (ARP37454_P050-HRP)
ARP37454_P050-HRP 100 µL

Rfxap Antibody - middle region : HRP (ARP37454_P050-HRP)

Sign In for Pricing
View Details
RCL Polyclonal Antibody, PerCP Conjugated
bs-7827R-PerCP 100 µL

RCL Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
TentaGel® HL-Br Resin
RTH-9331-01 1 g

TentaGel® HL-Br Resin

Sign In for Pricing
View Details
TentaGel® HL-Br Resin
RTH-9331-02 5 g

TentaGel® HL-Br Resin

Sign In for Pricing
View Details
TentaGel® HL-Br Resin
RTH-9331-03 25 g

TentaGel® HL-Br Resin

Sign In for Pricing
View Details
TentaGel® HL-Br Resin
RTH-9331-04 100 g

TentaGel® HL-Br Resin

Sign In for Pricing
View Details