Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGES Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Prostaglandin E synthase

Gene Aliases

Glutathione peroxidase PTGES; glutathione S-transferase 1-like 1; glutathione transferase PTGES; MGST1L1; MGST1-L1; MGST1-like 1; MGST-IV; microsomal glutathione S-transferase 1-like 1; microsomal prostaglandin E synthase-1; MPGES; mPGES-1; p53-induced apoptosis protein 12; p53-induced gene 12 protein; PGES; PIG12; PP102; PP1294; prostaglandin E synthase; TP53I12; tumor protein p53 inducible protein 12.

Gene ID

9536

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH08280.1

Reactivity

Human, Mouse

Immunogen

PTGES (AAH08280.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B) . Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq

Clonality

Monoclonal

Clone

2B9

Type

Monoclonal Antibody

Sequence

MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

Applications

Enzyme-linked immunosorbent assay|Immunoprecipitation

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

PTGES

Host or Source

Mouse

Protein Name

Homo sapiens prostaglandin E synthase, mRNA (cDNA clone MGC:10317 IMAGE:3623516), complete cds|Prostaglandin E synthase [Homo sapiens]

Gene Name URL

PTGES

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC008280

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPA1 (Inorganic Pyrophosphatase, Pyrophosphate Phospho-hydrolase, PPase, IOPPP, PP)
377930-01 50 µL

PPA1 (Inorganic Pyrophosphatase, Pyrophosphate Phospho-hydrolase, PPase, IOPPP, PP)

Sign In for Pricing
View Details
PPA1 (Inorganic Pyrophosphatase, Pyrophosphate Phospho-hydrolase, PPase, IOPPP, PP)
377930-02 100 µL

PPA1 (Inorganic Pyrophosphatase, Pyrophosphate Phospho-hydrolase, PPase, IOPPP, PP)

Sign In for Pricing
View Details
CD83 (HB15a) FITC
sc-19677 FITC 200 µg/mL

CD83 (HB15a) FITC

Sign In for Pricing
View Details
FOXO3 Protein Vector (Rat) (pPB-N-His)
PV268963 500 ng

FOXO3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
IL4R Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
24895061 1.0 µg DNA

IL4R Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human CCNL2 activation kit by CRISPRa
GA113106 1 Kit

Human CCNL2 activation kit by CRISPRa

Sign In for Pricing
View Details