What is the catalog number for PAGE4 Antibody?

The catalog number for PAGE4 Antibody is OAAL00459-100UG.

What sizes are available for PAGE4 Antibody?

PAGE4 Antibody is available in the following size(s): 100 µg.

Is PAGE4 Antibody in stock?

PAGE4 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

PAGE4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

PAGE family member 4

Gene Aliases

CT16.7; g antigen family C member 1; GAGE-9; GAGEC1; JM27; JM-27; P antigen family member 4; P antigen family, member 4 (prostate associated) ; PAGE-1; PAGE-4; prostate-associated gene protein 4.

Gene ID

9506

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_008934.1

Reactivity

Human, Mouse

Immunogen

PAGE4 (NP_008934.1, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq

Clonality

Monoclonal

Clone

7C3

Type

Monoclonal Antibody

Sequence

MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol