Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PICK1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein interacting with PRKCA 1

Gene Aliases

PICK; PRKCA-binding protein; PRKCABP; protein interacting with C kinase 1; protein kinase C-alpha-binding protein.

Gene ID

9463

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_036539

Reactivity

Human, Mouse, Rat

Immunogen

PRKCABP (NP_036539, 266 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA) . This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Clonality

Monoclonal

Clone

3G5

Type

Monoclonal Antibody

Sequence

KVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQ

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

PICK1

Host or Source

Mouse

Protein Name

Homo sapiens protein interacting with PRKCA 1 (PICK1), transcript variant 1, mRNA|PRKCA-binding protein [Homo sapiens]

Gene Name URL

PICK1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_012407

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prox1 Recombinant Antibody
bsm-62961R-01 20 µL

Prox1 Recombinant Antibody

Sign In for Pricing
View Details
Prox1 Recombinant Antibody
bsm-62961R-02 100 µL

Prox1 Recombinant Antibody

Sign In for Pricing
View Details
GPR34 Polyclonal Antibody
orb1413559 100 µL

GPR34 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Ankyrin repeat and SOCS box protein 10 (ASB10) ELISA Kit
MBS7215098-01 48 Well

Rat Ankyrin repeat and SOCS box protein 10 (ASB10) ELISA Kit

Sign In for Pricing
View Details
Rat Ankyrin repeat and SOCS box protein 10 (ASB10) ELISA Kit
MBS7215098-02 96 Well

Rat Ankyrin repeat and SOCS box protein 10 (ASB10) ELISA Kit

Sign In for Pricing
View Details
Rat Ankyrin repeat and SOCS box protein 10 (ASB10) ELISA Kit
MBS7215098-03 5x 96 Well

Rat Ankyrin repeat and SOCS box protein 10 (ASB10) ELISA Kit

Sign In for Pricing
View Details