What is the catalog number for ARHGEF1 Antibody?

The catalog number for ARHGEF1 Antibody is OAAL00440-100UG.

What sizes are available for ARHGEF1 Antibody?

ARHGEF1 Antibody is available in the following size(s): 100 µg.

Is ARHGEF1 Antibody in stock?

ARHGEF1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

ARHGEF1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Rho guanine nucleotide exchange factor 1

Gene Aliases

115 kDa guanine nucleotide exchange factor;115-kD protein; GEF1; IMD62; LBCL2; LSC; Lsc homolog; p115RhoGEF; P115-RHOGEF; Rho guanine nucleotide exchange factor (GEF) 1; rho guanine nucleotide exchange factor 1; SUB1.5.

Gene ID

9138

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH34013.2

Reactivity

Human, Mouse

Immunogen

ARHGEF1 (AAH34013.2, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq

Clonality

Monoclonal

Clone

2D2

Type

Monoclonal Antibody

Sequence

CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

ARHGEF1

Host or Source

Mouse

Protein Name

Homo sapiens Rho guanine nucleotide exchange factor (GEF) 1, mRNA (cDNA clone MGC:21456 IMAGE:3451036), complete cds|Rho guanine nucleotide exchange factor (GEF) 1 [Homo sapiens]