Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A14 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Solute carrier family 25 member 14

Gene Aliases

BMCP1; brain mitochondrial carrier protein 1; mitochondrial uncoupling protein 5; UCP5.

Gene ID

9016

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_003942.1

Reactivity

Human, Mouse

Immunogen

SLC25A14 (NP_003942.1, 1 a.a. ~ 325 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP) . UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is widely expressed in many tissues with the greatest abundance in brain and testis. The gene product has an N-terminal hydrophobic domain that is not present in other UCPs. Two splice variants have been found for this gene. [provided by RefSeq

Clonality

Monoclonal

Clone

1C12

Type

Monoclonal Antibody

Sequence

MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI

Applications

Enzyme-linked immunosorbent assay

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

SLC25A14

Host or Source

Mouse

Protein Name

Brain mitochondrial carrier protein 1 isoform UCP5L precursor [Homo sapiens]|Homo sapiens solute carrier family 25 (mitochondrial carrier, brain), member 14 (SLC25A14), transcript variant long, mRNA

Gene Name URL

SLC25A14

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_003951.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Phosphatidylcholine:ceramide cholinephosphotransferase 1 (SGMS1) ELISA Kit
GTR10341054 96 Well

Porcine Phosphatidylcholine:ceramide cholinephosphotransferase 1 (SGMS1) ELISA Kit

Sign In for Pricing
View Details
ENOPH1 siRNA (m)
sc-144654 10 µM

ENOPH1 siRNA (m)

Sign In for Pricing
View Details
RAI14 (NM_001145521) Human Tagged Lenti ORF Clone
RC227564L1 10 µg

RAI14 (NM_001145521) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LGALS3BP Rabbit Monoclonal Antibody
AMRe02213-01 50 µL

LGALS3BP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LGALS3BP Rabbit Monoclonal Antibody
AMRe02213-02 100 µL

LGALS3BP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LGALS3BP Rabbit Monoclonal Antibody
AMRe02213-03 200 µL

LGALS3BP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details