Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF1C Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

TATA-box binding protein associated factor, RNA polymerase I subunit C

Gene Aliases

MGC:39976; RNA polymerase I-specific TBP-associated factor 110 kDa; SL1; SL1, 110kD subunit; TAFI110; TAFI95; TATA box binding protein (TBP) -associated factor, RNA polymerase I, C, 110kD; TATA box binding protein (TBP) -associated factor, RNA polymerase I, C, 110kDa; TATA box-binding protein-associated factor 1C; TATA box-binding protein-associated factor RNA polymerase I subunit C; TATA-box binding protein associated factor, RNA polymerase I, C; TBP-associated factor 1C; transcription factor SL1; transcription initiation factor SL1/TIF-IB subunit C.

Gene ID

9013

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_005670.2

Reactivity

Human, Mouse

Immunogen

TAF1C (NP_005670.2, 761 a.a. ~ 869 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified. [provided by RefSeq

Clonality

Monoclonal

Clone

3000000

Type

Monoclonal Antibody

Sequence

SLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

TAF1C

Host or Source

Mouse

Protein Name

Homo sapiens TATA-box binding protein associated factor, RNA polymerase I subunit C (TAF1C), transcript variant 1, mRNA|TATA box-binding protein-associated factor RNA polymerase I subunit C isoform 1 [Homo sapiens]

Gene Name URL

TAF1C

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_005679

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGMN1 Antibody
orb2671158-01 50 µL

LGMN1 Antibody

Sign In for Pricing
View Details
LGMN1 Antibody
orb2671158-02 100 µL

LGMN1 Antibody

Sign In for Pricing
View Details
LGMN1 Antibody
orb2671158-03 200 µL

LGMN1 Antibody

Sign In for Pricing
View Details
(S) -2-O-Acetylmalic Anhydride
sc-208352 1 g

(S) -2-O-Acetylmalic Anhydride

Sign In for Pricing
View Details
KCNT2 Adenovirus (Mouse)
25433054 1.0 mL

KCNT2 Adenovirus (Mouse)

Sign In for Pricing
View Details
CD44 Antigen (CD44) Antibody (APC)
abx228365-01 20 Tests

CD44 Antigen (CD44) Antibody (APC)

Sign In for Pricing
View Details