Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK5 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

MAPK activated protein kinase 5

Gene Aliases

MAP kinase-activated protein kinase 5; MAPKAP kinase 5; MAPKAPK-5; MAPKAP-K5; mitogen-activated protein kinase-activated protein kinase 5; MK5; MK-5; p38-regulated/activated protein kinase; PRAK.

Gene ID

8550

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH47284

Reactivity

Human, Mouse

Immunogen

MAPKAPK5 (AAH47284, 371 a.a. ~ 471 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is a member of the serine/threonine kinase family. In response to cellular stress and proinflammatory cytokines, this kinase is activated through its phosphorylation by MAP kinases including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. In vitro, this kinase phosphorylates heat shock protein HSP27 at its physiologically relevant sites. Two alternately spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq

Clonality

Monoclonal

Clone

2D5

Type

Monoclonal Antibody

Sequence

KDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

MAPKAPK5

Host or Source

Mouse

Protein Name

Homo sapiens mitogen-activated protein kinase-activated protein kinase 5, mRNA (cDNA clone MGC:54058 IMAGE:4997201), complete cds|Mitogen-activated protein kinase-activated protein kinase 5 [Homo sapiens]

Gene Name URL

MAPKAPK5

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC047284

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGF Recombinant Antibody, Biotin Conjugated
bsm-52362R-Biotin-TR 20 µL

NGF Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Human LIF Protein, premium grade
LIF-H5215-50ug 50 µg

Human LIF Protein, premium grade

Sign In for Pricing
View Details
Human C-Type Lectin Domain Family 2, Member C (CLEC2C) ELISA Kit
JL15733-01 48 Tests

Human C-Type Lectin Domain Family 2, Member C (CLEC2C) ELISA Kit

Sign In for Pricing
View Details
Human C-Type Lectin Domain Family 2, Member C (CLEC2C) ELISA Kit
JL15733-02 96 Tests

Human C-Type Lectin Domain Family 2, Member C (CLEC2C) ELISA Kit

Sign In for Pricing
View Details
ARPC2 Protein Vector (Human) (pPB-His-MBP)
PV323914 500 ng

ARPC2 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
NSUN3 Human shRNA Lentiviral Particle (Locus ID 63899)
TL302878V 500 µL Each

NSUN3 Human shRNA Lentiviral Particle (Locus ID 63899)

Sign In for Pricing
View Details