Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKP4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Plakophilin 4

Gene Aliases

Catenin 4; p0071; plakophilin-4.

Gene ID

8502

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_001005476

Reactivity

Human, Mouse

Immunogen

PKP4 (NP_001005476, 12 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids in length. These proteins can be divided into subfamilies based on their number of repeats, their overall sequence similarity, and the dispersion of the repeats throughout their sequences. Members of the p120 (ctn) /plakophilin subfamily of Armadillo-like proteins, including CTNND1, CTNND2, PKP1, PKP2, PKP4, and ARVCF. PKP4 may be a component of desmosomal plaque and other adhesion plaques and is thought to be involved in regulating junctional plaque organization and cadherin function. Multiple transcript variants have been found for this gene, but the full-length nature of only two of them have been described so far. These two variants encode distinct isoforms. [provided by RefSeq

Clonality

Monoclonal

Clone

4H7

Type

Monoclonal Antibody

Sequence

EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

PKP4

Host or Source

Mouse

Protein Name

Homo sapiens plakophilin 4 (PKP4), transcript variant 2, mRNA|plakophilin-4 isoform b [Homo sapiens]

Gene Name URL

PKP4

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_001005476

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCER1G Adenovirus (Rat)
20376056 1.0 mL

FCER1G Adenovirus (Rat)

Sign In for Pricing
View Details
NUCB2 Protein Vector (Mouse) (pPB-N-His)
PV207123 500 ng

NUCB2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae ML0869 Protein (aa 1-229)
VAng-Yyj1741-inquire Inquire

Recombinant Mycobacterium Leprae ML0869 Protein (aa 1-229)

Sign In for Pricing
View Details
HCST (NM_001007469) Human Recombinant Protein
E45H34971M5 20 µg

HCST (NM_001007469) Human Recombinant Protein

Sign In for Pricing
View Details
Integrin beta 1 Mouse mAb, HRP conjugated
orb3163627 100 µL

Integrin beta 1 Mouse mAb, HRP conjugated

Sign In for Pricing
View Details
Anti-MEK7 Antibody
MBS178114-01 0.01 mg

Anti-MEK7 Antibody

Sign In for Pricing
View Details