What is the catalog number for FZD4 Antibody?

The catalog number for FZD4 Antibody is OAAL00393-50UG.

What sizes are available for FZD4 Antibody?

FZD4 Antibody is available in the following size(s): 50 µg.

Is FZD4 Antibody in stock?

FZD4 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

FZD4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Frizzled class receptor 4

Gene Aliases

CD344; EVR1; FEVR; frizzled 4, seven transmembrane spanning receptor; frizzled family receptor 4; frizzled homolog 4; frizzled-4; Fz4; Fz-4; FZD4S; FzE4; GPCR; hFz4; WNT receptor frizzled-4.

Gene ID

8322

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_036325

Reactivity

Human, Mouse

Immunogen

FZD4 (NP_036325, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq

Clonality

Monoclonal

Clone

3G7

Type

Monoclonal Antibody

Sequence

TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol