What is the catalog number for BEST1 Antibody?

The catalog number for BEST1 Antibody is OAAL00353-100UG.

What sizes are available for BEST1 Antibody?

BEST1 Antibody is available in the following size(s): 100 µg.

Is BEST1 Antibody in stock?

BEST1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

BEST1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Bestrophin 1

Gene Aliases

ARB; BEST; Best disease; Best1V1Delta2; bestrophin-1; BMD; RP50; TU15B; vitelliform macular dystrophy protein 2; VMD2.

Gene ID

7439

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH41664

Reactivity

Human, Mouse

Immunogen

VMD2 (AAH41664, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene encodes a member of the bestrophin gene family. This small gene family is characterized by proteins with a highly conserved N-terminus with four to six transmembrane domains. Bestrophins may form chloride ion channels or may regulate voltage-gated L-type calcium-ion channels. Bestrophins are generally believed to form calcium-activated chloride-ion channels in epithelial cells but they have also been shown to be highly permeable to bicarbonate ion transport in retinal tissue. Mutations in this gene are responsible for juvenile-onset vitelliform macular dystrophy (VMD2), also known as Best macular dystrophy, in addition to adult-onset vitelliform macular dystrophy (AVMD) and other retinopathies. Alternative splicing results in multiple variants encoding distinct isoforms

Clonality

Monoclonal

Clone

1C2

Type

Monoclonal Antibody

Sequence

LHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESD

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol