Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2B Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Ubiquitin conjugating enzyme E2 B

Gene Aliases

E2 protein; E2 ubiquitin-conjugating enzyme B; E2-17kDa; HHR6B; HR6B; RAD6 homolog B; RAD6B; UBC2; ubiquitin carrier protein B; ubiquitin conjugating enzyme E2B; ubiquitin-conjugating enzyme E2 B; ubiquitin-conjugating enzyme E2-17 kDa; ubiquitin-conjugating enzyme E2B (RAD6 homolog) ; ubiquitin-protein ligase B.

Gene ID

7320

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_003328.1

Reactivity

Human, Mouse

Immunogen

UBE2B (NP_003328.1, 63 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. [provided by RefSeq

Clonality

Monoclonal

Clone

4C3

Type

Monoclonal Antibody

Sequence

YPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

UBE2B

Host or Source

Mouse

Protein Name

Homo sapiens ubiquitin conjugating enzyme E2 B (UBE2B), mRNA|ubiquitin-conjugating enzyme E2 B [Homo sapiens]

Gene Name URL

UBE2B

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_003337

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPNMB Polyclonal Antibody, FITC Conjugated
bs-2684R-FITC-01 20 µL

GPNMB Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
GPNMB Polyclonal Antibody, FITC Conjugated
bs-2684R-FITC-02 100 µL

GPNMB Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Laminin Gamma 2 (LAMC2) Monoclonal Antibody
CAU30769-01 100 µL

Laminin Gamma 2 (LAMC2) Monoclonal Antibody

Sign In for Pricing
View Details
Laminin Gamma 2 (LAMC2) Monoclonal Antibody
CAU30769-02 200 µL

Laminin Gamma 2 (LAMC2) Monoclonal Antibody

Sign In for Pricing
View Details
Laminin Gamma 2 (LAMC2) Monoclonal Antibody
CAU30769-03 1 mL

Laminin Gamma 2 (LAMC2) Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-OR52R1 antibody
SL17910R-01 50 µL

Rabbit Anti-OR52R1 antibody

Sign In for Pricing
View Details