Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEK Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

TEK receptor tyrosine kinase

Gene Aliases

Angiopoietin-1 receptor; CD202B; endothelial tyrosine kinase; GLC3E; TEK tyrosine kinase, endothelial; TIE2; TIE-2; tunica interna endothelial cell kinase; tyrosine kinase with Ig and EGF homology domains-2; tyrosine-protein kinase receptor TEK; tyrosine-protein kinase receptor TIE-2; VMCM; VMCM1.

Gene ID

7010

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH35514

Reactivity

Human, Mouse

Immunogen

TEK (AAH35514, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase. [provided by RefSeq

Clonality

Monoclonal

Clone

1G10

Type

Monoclonal Antibody

Sequence

AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2a Kappa

NCBI Gene Symbol

TEK

Host or Source

Mouse

Protein Name

Homo sapiens TEK tyrosine kinase, endothelial, mRNA (cDNA clone MGC:34502 IMAGE:5228999), complete cds|TEK tyrosine kinase, endothelial [Homo sapiens]

Gene Name URL

TEK

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC035514

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)
MBS1083877-01 0.02 mg (E-Coli)

Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)

Sign In for Pricing
View Details
Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)
MBS1083877-02 0.1 mg (E-Coli)

Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)

Sign In for Pricing
View Details
Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)
MBS1083877-03 0.02 mg (Yeast)

Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)

Sign In for Pricing
View Details
Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)
MBS1083877-04 0.1 mg (Yeast)

Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)

Sign In for Pricing
View Details
Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)
MBS1083877-05 0.02 mg (Baculovirus)

Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)

Sign In for Pricing
View Details
Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)
MBS1083877-06 0.02 mg (Mammalian-Cell)

Recombinant Alteromonas macleodii Probable transcriptional regulatory protein MADE_1004275 (MADE_1004275)

Sign In for Pricing
View Details