Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX3 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

T-box transcription factor 3

Gene Aliases

Bladder cancer related protein XHL; T-box 3; T-box protein 3; T-box transcription factor TBX3; TBX3-ISO; UMS; XHL.

Gene ID

6926

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_005987

Reactivity

Human, Mouse

Immunogen

TBX3 (NP_005987, 311 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq

Clonality

Monoclonal

Clone

7B3

Type

Monoclonal Antibody

Sequence

KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

TBX3

Host or Source

Mouse

Protein Name

Homo sapiens T-box 3 (TBX3), transcript variant 1, mRNA|T-box transcription factor TBX3 isoform 1 [Homo sapiens]

Gene Name URL

TBX3

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_005996

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC beta2, CT (PRKCB, PKCB, PRKCB1, Protein kinase C beta type) (PE)
MBS6334332-01 0.2 mL

PKC beta2, CT (PRKCB, PKCB, PRKCB1, Protein kinase C beta type) (PE)

Sign In for Pricing
View Details
PKC beta2, CT (PRKCB, PKCB, PRKCB1, Protein kinase C beta type) (PE)
MBS6334332-02 5x 0.2 mL

PKC beta2, CT (PRKCB, PKCB, PRKCB1, Protein kinase C beta type) (PE)

Sign In for Pricing
View Details
CXCL1 antibody
FNab03658 100 µg

CXCL1 antibody

Sign In for Pricing
View Details
Cyclophilin B/PPIB Rabbit Polyclonal Antibody (Carrier-free)
orb3108404 100 µg

Cyclophilin B/PPIB Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Ethyl 5-bromo-1,2-oxazole-4-carboxylate
QID58265-01 50 mg

Ethyl 5-bromo-1,2-oxazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 5-bromo-1,2-oxazole-4-carboxylate
QID58265-02 0.5 g

Ethyl 5-bromo-1,2-oxazole-4-carboxylate

Sign In for Pricing
View Details