Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBL1X Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Transducin beta like 1 X-linked

Gene Aliases

CHNG8; EBI; F-box-like/WD repeat-containing protein TBL1X; SMAP55; TBL1; transducin beta like 1X-linked; transducin beta-like protein 1X; transducin-beta-like protein 1, X-linked.

Gene ID

6907

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_005638

Reactivity

Human, Mouse

Immunogen

TBL1X (NP_005638, 478 a.a. ~ 577 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene. [provided by RefSeq

Clonality

Monoclonal

Clone

2B6

Type

Monoclonal Antibody

Sequence

LASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK

Applications

Enzyme-linked immunosorbent assay|Immunohistochemistry-Paraffin|Proximity ligation assay

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

TBL1X

Host or Source

Mouse

Protein Name

F-box-like/WD repeat-containing protein TBL1X isoform a [Homo sapiens]|Homo sapiens transducin beta like 1 X-linked (TBL1X), transcript variant 1, mRNA

Gene Name URL

TBL1X

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_005647

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)
MBS2096697-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)
MBS2096697-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)
MBS2096697-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)
MBS2096697-04 1 mL

Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)
MBS2096697-05 5 mL

Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)
MBS2096697-06 5x 5 mL

Biotin-Linked Polyclonal Antibody to Coiled Coil Domain Containing Protein 80 (CCDC80)

Sign In for Pricing
View Details