Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF11 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

TATA-box binding protein associated factor 11

Gene Aliases

MGC:15243; PRO2134; TAF (II) 28; TAF11 RNA polymerase II, TATA box binding protein (TBP) -associated factor, 28kDa; TAF2I; TAFII28; TAFII-28; TATA box binding protein (TBP) -associated factor, RNA polymerase II, I, 28kD; TFIID subunit p30-beta; transcription initiation factor TFIID 28 kD subunit; transcription initiation factor TFIID 28 kDa subunit; transcription initiation factor TFIID subunit 11.

Gene ID

6882

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_005634

Reactivity

Human, Mouse

Immunogen

TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure. [provided by RefSeq

Clonality

Monoclonal

Clone

3H5

Type

Monoclonal Antibody

Sequence

SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

TAF11

Host or Source

Mouse

Protein Name

Homo sapiens TATA-box binding protein associated factor 11 (TAF11), transcript variant 1, mRNA|transcription initiation factor TFIID subunit 11 isoform 1 [Homo sapiens]

Gene Name URL

TAF11

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_005643

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Methylfuro[2,3-d]pyrimidin-4 (3H) -one
OR1056198-01 100 mg

5-Methylfuro[2,3-d]pyrimidin-4 (3H) -one

Sign In for Pricing
View Details
5-Methylfuro[2,3-d]pyrimidin-4 (3H) -one
OR1056198-02 250 mg

5-Methylfuro[2,3-d]pyrimidin-4 (3H) -one

Sign In for Pricing
View Details
pLKO.1-U6-GSDME-shRNA3-PGK-Hygro Plasmid
PVT40807 2 µg

pLKO.1-U6-GSDME-shRNA3-PGK-Hygro Plasmid

Sign In for Pricing
View Details
Anti-Perilipin 3 Antibody, Rabbit Polyclonal
MBS8108101-01 0.1 mL

Anti-Perilipin 3 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Perilipin 3 Antibody, Rabbit Polyclonal
MBS8108101-02 5x 0.1 mL

Anti-Perilipin 3 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Recombinant human Osteopontin/OPN protein
ATGP3951-250 250 µg

Recombinant human Osteopontin/OPN protein

Sign In for Pricing
View Details