Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A3 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Sulfotransferase family 1A member 3

Gene Aliases

Aryl sulfotransferase 1A3/1A4; catecholamine-sulfating phenol sulfotransferase; dopamine-specific sulfotransferase; HAST; HAST3; monoamine-sulfating phenosulfotransferase; M-PST; phenol sulfotransferase 1A5; placental estrogen sulfotransferase; ST1A3; ST1A3/ST1A4; ST1A4; ST1A5; STM; sulfokinase; sulfotransferase 1A3; Sulfotransferase 1A4; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3; thermolabile (monoamine, M form) phenol sulfotransferase; TL-PST.

Gene ID

6818

Accession Number

https://www.ncbi.nlm.nih.gov/protein/AAH14471

Reactivity

Human, Mouse

Immunogen

SULT1A3 (AAH14471, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Exons of this gene overlap with exons of a gene that encodes a protein containing GIY-YIG domains (GIYD1) . Multiple alternatively spliced variants that encode the same protein have been described. [provided by RefSeq

Clonality

Monoclonal

Clone

1F3

Type

Monoclonal Antibody

Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Applications

Enzyme-linked immunosorbent assay|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG1 Kappa

NCBI Gene Symbol

SULT1A3

Host or Source

Mouse

Protein Name

Homo sapiens sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4, mRNA (cDNA clone MGC:23115 IMAGE:4907290), complete cds|Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 [Homo sapiens]

Gene Name URL

SULT1A3

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/BC014471

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tmem176b (NM_001286652) AAV Particle
MR228870A1V 250 µL

Mouse Tmem176b (NM_001286652) AAV Particle

Sign In for Pricing
View Details
beta Catenin antibody
20R-1973 50 ug

beta Catenin antibody

Sign In for Pricing
View Details
Goat Anti-Human IgG, Mouse ads-BIOT
2044-08 1 mg

Goat Anti-Human IgG, Mouse ads-BIOT

Sign In for Pricing
View Details
PRP4 kinase CRISPR Activation Plasmid (m)
sc-422432-ACT 20 µg

PRP4 kinase CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
CCND1, CT (T288) (CCND1, BCL1, PRAD1, G1/S-specific cyclin-D1, B Cell lymphoma 1 protein, BCL-1 oncogene, PRAD1 oncogene) (FITC) discontinued
033399-FITC 200 µL

CCND1, CT (T288) (CCND1, BCL1, PRAD1, G1/S-specific cyclin-D1, B Cell lymphoma 1 protein, BCL-1 oncogene, PRAD1 oncogene) (FITC) discontinued

Sign In for Pricing
View Details
KLF15, CT (KLF15, KKLF, Krueppel-like factor 15, Kidney-enriched krueppel-like factor) (MaxLight 650)
MBS6313938-01 0.1 mL

KLF15, CT (KLF15, KKLF, Krueppel-like factor 15, Kidney-enriched krueppel-like factor) (MaxLight 650)

Sign In for Pricing
View Details