What is the catalog number for ST14 Antibody?

The catalog number for ST14 Antibody is OAAL00317-100UG.

What sizes are available for ST14 Antibody?

ST14 Antibody is available in the following size(s): 100 µg.

Is ST14 Antibody in stock?

ST14 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

ST14 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

ST14 transmembrane serine protease matriptase

Gene Aliases

ARCI11; CAP3; channel-activating protein 3; HAI; membrane-type serine protease 1; MTSP1; MT-SP1; prostamin; PRSS14; serine protease 14; serine protease TADG-15; SNC19; suppression of tumorigenicity 14 (colon carcinoma) ; suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin) ; suppressor of tumorigenicity 14 protein; TADG15; TMPRSS14; tumor associated differentially expressed gene 15 protein.

Gene ID

6768

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_068813

Reactivity

Human, Mouse

Immunogen

ST14 (NP_068813, 298 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. [provided by RefSeq

Clonality

Monoclonal

Clone

2F4

Type

Monoclonal Antibody

Sequence

PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD

Applications

Enzyme-linked immunosorbent assay

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol