Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RING1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Ring finger protein 1

Gene Aliases

E3 ubiquitin-protein ligase RING1; polycomb complex protein RING1; really interesting new gene 1 protein; RING1A; RING-type E3 ubiquitin transferase RING1; RNF1.

Gene ID

6015

Accession Number

https://www.ncbi.nlm.nih.gov/protein/NP_002922

Reactivity

Human, Mouse

Immunogen

RING1 (NP_002922, 81 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Target

This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. [provided by RefSeq

Clonality

Monoclonal

Clone

400000000

Type

Monoclonal Antibody

Sequence

NKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMS

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid

Reconstitution

Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

Fragment

IgG2b Kappa

NCBI Gene Symbol

RING1

Host or Source

Mouse

Protein Name

E3 ubiquitin-protein ligase RING1 [Homo sapiens]|Homo sapiens ring finger protein 1 (RING1), mRNA

Gene Name URL

RING1

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_002931

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp6v1g2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6569006 1.0 µg DNA

Atp6v1g2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Olfr1388 ORF Vector (Mouse) (pORF)
32833014 1.0 µg DNA

Olfr1388 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
St7l AAV siRNA Pooled Vector
45653166 1.0 µg

St7l AAV siRNA Pooled Vector

Sign In for Pricing
View Details
2- (3-Chlorophenoxy) -N-hydroxyethanimidamide
sc-298076A 1 g

2- (3-Chlorophenoxy) -N-hydroxyethanimidamide

Sign In for Pricing
View Details
Alpha-omega-Disuccinimidyl ester poly (ethyleneglycol), PEG molecular weight 6,000 daltons
BIP1187-01 100 mg

Alpha-omega-Disuccinimidyl ester poly (ethyleneglycol), PEG molecular weight 6,000 daltons

Sign In for Pricing
View Details
Alpha-omega-Disuccinimidyl ester poly (ethyleneglycol), PEG molecular weight 6,000 daltons
BIP1187-02 250 mg

Alpha-omega-Disuccinimidyl ester poly (ethyleneglycol), PEG molecular weight 6,000 daltons

Sign In for Pricing
View Details